Recombinant Human MDG1 Protein

Images

 
SDS-Page: Recombinant Human MDG1 Protein [H00004189-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MDG1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 223 of Human DNAJB9 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
DNAJB9
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MDG1 Protein

  • DKFZp564F1862
  • DnaJ (Hsp40) homolog, subfamily B, member 9
  • dnaJ homolog subfamily B member 9
  • endoplasmic reticulum DnaJ homolog 4
  • ERdj4
  • Mdg-1
  • MDG1MSTP049
  • Microvascular endothelial differentiation gene 1 protein
  • MST049

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
AF1543
Species: Hu
Applications: WB, IHC
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-82787
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2323
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02377
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-58498
Species: Hu
Applications: ICC/IF

Publications for MDG1 Recombinant Protein (H00004189-P01) (0)

There are no publications for MDG1 Recombinant Protein (H00004189-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDG1 Recombinant Protein (H00004189-P01) (0)

There are no reviews for MDG1 Recombinant Protein (H00004189-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MDG1 Recombinant Protein (H00004189-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MDG1 Products

Bioinformatics Tool for MDG1 Recombinant Protein (H00004189-P01)

Discover related pathways, diseases and genes to MDG1 Recombinant Protein (H00004189-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDG1 Recombinant Protein (H00004189-P01)

Discover more about diseases related to MDG1 Recombinant Protein (H00004189-P01).
 

Pathways for MDG1 Recombinant Protein (H00004189-P01)

View related products by pathway.

PTMs for MDG1 Recombinant Protein (H00004189-P01)

Learn more about PTMs related to MDG1 Recombinant Protein (H00004189-P01).

Blogs on MDG1

There are no specific blogs for MDG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MDG1 Antibody
NBP1-87731
ATF6 Antibody (70B1413.1)
NBP1-40256-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MDG1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJB9