MCM5 Antibody

Images

 
Western Blot: MCM5 Antibody [NBP1-58191] - Titration: 2.5ug/ml, Positive Control: HepG2 cell lysate.

Product Details

Summary
Product Discontinued
View other related MCM5 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-58191
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MCM5 Antibody Summary

Immunogen
Synthetic peptides corresponding to MCM5 (minichromosome maintenance complex component 5) The peptide sequence was selected from the N terminal of MCM5. Peptide sequence MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG.
Clonality
Polyclonal
Host
Rabbit
Gene
MCM5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MCM5 and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MCM5 Antibody

  • CDC46 homolog
  • CDC46DNA replication licensing factor MCM5
  • EC 3.6.4.12
  • MCM5 minichromosome maintenance deficient 5, cell division cycle 46 (S.cerevisiae)
  • MCM5 minichromosome maintenance deficient 5, cell division cycle 46
  • MGC5315
  • minichromosome maintenance complex component 5
  • minichromosome maintenance deficient (S. cerevisiae) 5 (cell division cycle 46)
  • minichromosome maintenance deficient 5 (cell division cycle 46)
  • P1-CDC46

Background

The protein encoded by MCM5 is structurally very similar to the CDC46 protein from S. cerevisiae, a protein involved in the initiation of DNA replication. The encoded protein is a member of the MCM family of chromatin-binding proteins and can interact with at least two other members of this family. The encoded protein is upregulated in the transition from the G0 to G1/S phase of the cell cycle and may actively participate in cell cycle regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB92171
Species: Hu
Applications: WB, Flow, IHC, ICC
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NB100-639
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PLA
H00004173-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85797
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82642
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46192
Species: Hu
Applications: WB, IHC
NBP1-85723
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, IHC-FrFl
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32708
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008706-T01
Species: Hu
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-69571
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-62583
Species: Hu
Applications: WB
NB100-74635
Species: Hu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP
NBP1-58191
Species: Hu
Applications: WB

Publications for MCM5 Antibody (NBP1-58191) (0)

There are no publications for MCM5 Antibody (NBP1-58191).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCM5 Antibody (NBP1-58191) (0)

There are no reviews for MCM5 Antibody (NBP1-58191). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCM5 Antibody (NBP1-58191) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCM5 Antibody Products

Related Products by Gene

Bioinformatics Tool for MCM5 Antibody (NBP1-58191)

Discover related pathways, diseases and genes to MCM5 Antibody (NBP1-58191). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM5 Antibody (NBP1-58191)

Discover more about diseases related to MCM5 Antibody (NBP1-58191).
 

Pathways for MCM5 Antibody (NBP1-58191)

View related products by pathway.

PTMs for MCM5 Antibody (NBP1-58191)

Learn more about PTMs related to MCM5 Antibody (NBP1-58191).
 

Research Areas for MCM5 Antibody (NBP1-58191)

Find related products by research area.

Blogs on MCM5

There are no specific blogs for MCM5, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol MCM5
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-58191 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.