MCM5 Antibody


Western Blot: MCM5 Antibody [NBP1-58191] - Titration: 2.5ug/ml, Positive Control: HepG2 cell lysate.

Product Details

Product Discontinued
View other related MCM5 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MCM5 Antibody Summary

Synthetic peptides corresponding to MCM5 (minichromosome maintenance complex component 5) The peptide sequence was selected from the N terminal of MCM5. Peptide sequence MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MCM5 and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MCM5 Antibody

  • CDC46 homolog
  • CDC46DNA replication licensing factor MCM5
  • EC
  • MCM5 minichromosome maintenance deficient 5, cell division cycle 46 (S.cerevisiae)
  • MCM5 minichromosome maintenance deficient 5, cell division cycle 46
  • MGC5315
  • minichromosome maintenance complex component 5
  • minichromosome maintenance deficient (S. cerevisiae) 5 (cell division cycle 46)
  • minichromosome maintenance deficient 5 (cell division cycle 46)
  • P1-CDC46


The protein encoded by MCM5 is structurally very similar to the CDC46 protein from S. cerevisiae, a protein involved in the initiation of DNA replication. The encoded protein is a member of the MCM family of chromatin-binding proteins and can interact with at least two other members of this family. The encoded protein is upregulated in the transition from the G0 to G1/S phase of the cell cycle and may actively participate in cell cycle regulation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, IHC-FrFl
Species: Hu, Mu, Rt, Pm
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
Species: Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB

Publications for MCM5 Antibody (NBP1-58191) (0)

There are no publications for MCM5 Antibody (NBP1-58191).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCM5 Antibody (NBP1-58191) (0)

There are no reviews for MCM5 Antibody (NBP1-58191). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCM5 Antibody (NBP1-58191) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MCM5 Antibody Products

Related Products by Gene

Bioinformatics Tool for MCM5 Antibody (NBP1-58191)

Discover related pathways, diseases and genes to MCM5 Antibody (NBP1-58191). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM5 Antibody (NBP1-58191)

Discover more about diseases related to MCM5 Antibody (NBP1-58191).

Pathways for MCM5 Antibody (NBP1-58191)

View related products by pathway.

PTMs for MCM5 Antibody (NBP1-58191)

Learn more about PTMs related to MCM5 Antibody (NBP1-58191).

Research Areas for MCM5 Antibody (NBP1-58191)

Find related products by research area.

Blogs on MCM5

There are no specific blogs for MCM5, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our MCM5 Antibody and receive a gift card or discount.


Gene Symbol MCM5