Recombinant Human MCM3AP Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MCM3AP Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human MCM3AP

Source: Wheat Germ

Amino Acid Sequence: VRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTARKKLRRQMRAFPAAPCCVDVSDRLRALAPSAECPIAEENLARGLLDLGHA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MCM3AP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00008888-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MCM3AP Protein

  • 80 kDa MCM3-associated protein
  • FLJ44336
  • GANPFLJ45306
  • human mRNA for MCM3 import factor10Protein GANP
  • KIAA0572MAP80germinal center-associated nuclear protein
  • Map80
  • MCM3 import protein
  • MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein
  • MCM3 minichromosome maintenance deficient 3 associated protein
  • minichromosome maintenance complex component 3 associated protein
  • minichromosome maintenance deficient (S. cerevisiae) 3-associated protein
  • minichromosome maintenance deficient 3-associated protein

Background

MCM3AP - MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-289
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
26160002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00200576-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-65123
Species: Hu
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP1-57160
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-64893
Species: Hu
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1894
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF3635
Species: Mu
Applications: WB, IHC
NBP2-33582
Species: Hu, Mk
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00022908-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-76978
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
H00151648-M01
Species: Hu
Applications: WB, ELISA, IP
NBP1-81765
Species: Hu
Applications: IHC, IHC-P

Publications for MCM3AP Partial Recombinant Protein (H00008888-Q01)(1)

Reviews for MCM3AP Partial Recombinant Protein (H00008888-Q01) (0)

There are no reviews for MCM3AP Partial Recombinant Protein (H00008888-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCM3AP Partial Recombinant Protein (H00008888-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MCM3AP Products

Bioinformatics Tool for MCM3AP Partial Recombinant Protein (H00008888-Q01)

Discover related pathways, diseases and genes to MCM3AP Partial Recombinant Protein (H00008888-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM3AP Partial Recombinant Protein (H00008888-Q01)

Discover more about diseases related to MCM3AP Partial Recombinant Protein (H00008888-Q01).
 

Pathways for MCM3AP Partial Recombinant Protein (H00008888-Q01)

View related products by pathway.

PTMs for MCM3AP Partial Recombinant Protein (H00008888-Q01)

Learn more about PTMs related to MCM3AP Partial Recombinant Protein (H00008888-Q01).

Blogs on MCM3AP

There are no specific blogs for MCM3AP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MCM3AP Antibody
NBP1-83393

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MCM3AP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MCM3AP