MCM3AP Antibody (1H3) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related MCM3AP Primary Antibodies

Order Details


    • Catalog Number
      H00008888-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MCM3AP Antibody (1H3) [PE] Summary

Immunogen
MCM3AP (AAH13285, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTARKKLRRQMRAFPAAPCCVDVSDRLRALAPSAECPIAEENLARGLLDLGHA
Specificity
MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MCM3AP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MCM3AP Antibody (1H3) [PE]

  • 80 kDa MCM3-associated protein
  • FLJ44336
  • GANPFLJ45306
  • human mRNA for MCM3 import factor10Protein GANP
  • KIAA0572MAP80germinal center-associated nuclear protein
  • Map80
  • MCM3 import protein
  • MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein
  • MCM3 minichromosome maintenance deficient 3 associated protein
  • minichromosome maintenance complex component 3 associated protein
  • minichromosome maintenance deficient (S. cerevisiae) 3-associated protein
  • minichromosome maintenance deficient 3-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-249
Species: Hu
Applications: WB, IHC, PLA, ICC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
26160002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00200576-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1894
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00022908-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-76978
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
H00151648-M01
Species: Hu
Applications: WB, ELISA, IP
NBP1-81765
Species: Hu
Applications: IHC, IHC-P

Publications for MCM3AP Antibody (H00008888-M01PE) (0)

There are no publications for MCM3AP Antibody (H00008888-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCM3AP Antibody (H00008888-M01PE) (0)

There are no reviews for MCM3AP Antibody (H00008888-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MCM3AP Antibody (H00008888-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCM3AP Products

Bioinformatics Tool for MCM3AP Antibody (H00008888-M01PE)

Discover related pathways, diseases and genes to MCM3AP Antibody (H00008888-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM3AP Antibody (H00008888-M01PE)

Discover more about diseases related to MCM3AP Antibody (H00008888-M01PE).
 

Pathways for MCM3AP Antibody (H00008888-M01PE)

View related products by pathway.

PTMs for MCM3AP Antibody (H00008888-M01PE)

Learn more about PTMs related to MCM3AP Antibody (H00008888-M01PE).

Blogs on MCM3AP

There are no specific blogs for MCM3AP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCM3AP Antibody (1H3) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol MCM3AP