MCM3 Antibody


Western Blot: MCM3 Antibody [NBP1-58088] - 721_B cell lysate, Antibody Titration: 0.2-1 ug/ml.
Immunohistochemistry-Paraffin: MCM3 Antibody [NBP1-58088] - Human Brain, cortex tissue at an antibody concentration of 5ug/ml.

Product Details

Product Discontinued
View other related MCM3 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MCM3 Antibody Summary

Synthetic peptides corresponding to MCM3(minichromosome maintenance complex component 3) The peptide sequence was selected from the C terminal of MCM3. Peptide sequence YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 2-5 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MCM3 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MCM3 Antibody

  • cervical cancer proto-oncogene 5
  • DNA polymerase alpha holoenzyme-associated protein P1
  • DNA replication factor MCM3
  • DNA replication licensing factor MCM3
  • EC
  • HCC5
  • hRlf beta subunit
  • MCM3 minichromosome maintenance deficient 3 (S. cerevisiae)
  • MCM3 minichromosome maintenance deficient 3
  • MGC1157
  • minichromosome maintenance complex component 3
  • minichromosome maintenance deficient (S. cerevisiae) 3
  • minichromosome maintenance deficient 3
  • P1.h
  • p102
  • P1-MCM3
  • replication licensing factor, beta subunit
  • RLF subunit beta
  • RLFB


MCM3 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, IP, PLA
Species: Hu, Xp
Applications: WB, IHC, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IP
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IP
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA

Publications for MCM3 Antibody (NBP1-58088) (0)

There are no publications for MCM3 Antibody (NBP1-58088).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCM3 Antibody (NBP1-58088) (0)

There are no reviews for MCM3 Antibody (NBP1-58088). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCM3 Antibody (NBP1-58088) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MCM3 Products

Bioinformatics Tool for MCM3 Antibody (NBP1-58088)

Discover related pathways, diseases and genes to MCM3 Antibody (NBP1-58088). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM3 Antibody (NBP1-58088)

Discover more about diseases related to MCM3 Antibody (NBP1-58088).

Pathways for MCM3 Antibody (NBP1-58088)

View related products by pathway.

PTMs for MCM3 Antibody (NBP1-58088)

Learn more about PTMs related to MCM3 Antibody (NBP1-58088).

Research Areas for MCM3 Antibody (NBP1-58088)

Find related products by research area.

Blogs on MCM3

There are no specific blogs for MCM3, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MCM3 Antibody and receive a gift card or discount.


Gene Symbol MCM3