Recombinant Human MCM2 Protein

Images

 
SDS-Page: Recombinant Human MCM2 Protein [H00004171-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human MCM2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 805-904 of Human MCM2

Source: Wheat Germ

Amino Acid Sequence: TQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MCM2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00004171-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MCM2 Protein

  • BM28
  • BM28MGC10606
  • CCNL 1
  • CCNL1
  • cdc19
  • CDCL1
  • CDCL1mitotin
  • D3S3194
  • EC 3.6.4.12
  • KIAA0030MITOTIN
  • MCM2 minichromosome maintenance deficient 2, mitotin (S. cerevisiae)
  • MCM2
  • minichromosome maintenance complex component 2
  • minichromosome maintenance deficient (S. cerevisiae) 2 (mitotin)
  • minichromosome maintenance deficient 2 (mitotin)
  • Mitotin

Background

MCM2 - MCM2 minichromosome maintenance deficient 2, mitotin (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-79778
Species: Hu, Xp
Applications: WB, IHC, IP
H00004173-B01P
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-75569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82642
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP2-46192
Species: Hu
Applications: WB, IHC
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00010926-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-67897
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2567
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00004171-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for MCM2 Partial Recombinant Protein (H00004171-Q01)(1)

Reviews for MCM2 Partial Recombinant Protein (H00004171-Q01) (0)

There are no reviews for MCM2 Partial Recombinant Protein (H00004171-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCM2 Partial Recombinant Protein (H00004171-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for MCM2 Partial Recombinant Protein (H00004171-Q01)

Discover related pathways, diseases and genes to MCM2 Partial Recombinant Protein (H00004171-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM2 Partial Recombinant Protein (H00004171-Q01)

Discover more about diseases related to MCM2 Partial Recombinant Protein (H00004171-Q01).
 

Pathways for MCM2 Partial Recombinant Protein (H00004171-Q01)

View related products by pathway.

PTMs for MCM2 Partial Recombinant Protein (H00004171-Q01)

Learn more about PTMs related to MCM2 Partial Recombinant Protein (H00004171-Q01).
 

Research Areas for MCM2 Partial Recombinant Protein (H00004171-Q01)

Find related products by research area.

Blogs on MCM2

There are no specific blogs for MCM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
MCM2 Antibody
NB100-288

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MCM2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MCM2
Entrez