Recombinant Human MCHR1 Protein

Images

 
There are currently no images for MCHR1 Recombinant Protein (H00002847-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AP

Order Details

Recombinant Human MCHR1 Protein Summary

Description
An untagged recombinant protein corresponding to the amino acid sequence of (AAH21146.1) for Human MCHR1

Source: Wheat Germ

Amino Acid Sequence: MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MCHR1
Purity
N/A

Applications/Dilutions

Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl pH8.0 in 2% glycerol.
Preservative
No Preservative
Purity
N/A

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MCHR1 Protein

  • G protein-coupled receptor 24
  • GPR24
  • GPR24SLC-1
  • G-protein coupled receptor 24
  • MCH receptor 1
  • MCH1R
  • MCH-1R
  • MCH1RMCHR-1
  • MCHR1
  • MCH-R1
  • melanin-concentrating hormone receptor 1
  • MGC32129
  • SLC1
  • SLC1MCHR
  • Somatostatin receptor-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13780
Species: Hu
Applications: IHC, IHC-P
NLS1907
Species: Hu
Applications: IHC, IHC-P, ICC
NLS418
Species: Hu
Applications: IHC-P
NLS2756
Species: Hu, Mk
Applications: IHC-P, ICC
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
NLS1014
Species: Hu, Mu, Rt, Bt, Bv, Ca, Eq, Ha, Mk, Pm
Applications: IHC-P
H00442206-R02
Species: Hu
NLS2576
Species: Hu, Mk
Applications: IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
H00002847-G01
Species: Hu
Applications: AP

Publications for MCHR1 Recombinant Protein (H00002847-G01) (0)

There are no publications for MCHR1 Recombinant Protein (H00002847-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCHR1 Recombinant Protein (H00002847-G01) (0)

There are no reviews for MCHR1 Recombinant Protein (H00002847-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for MCHR1 Recombinant Protein (H00002847-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for MCHR1 Recombinant Protein (H00002847-G01)

Discover related pathways, diseases and genes to MCHR1 Recombinant Protein (H00002847-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCHR1 Recombinant Protein (H00002847-G01)

Discover more about diseases related to MCHR1 Recombinant Protein (H00002847-G01).
 

Pathways for MCHR1 Recombinant Protein (H00002847-G01)

View related products by pathway.

PTMs for MCHR1 Recombinant Protein (H00002847-G01)

Learn more about PTMs related to MCHR1 Recombinant Protein (H00002847-G01).
 

Research Areas for MCHR1 Recombinant Protein (H00002847-G01)

Find related products by research area.

Blogs on MCHR1

There are no specific blogs for MCHR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

POMC Antibody
NB100-1533

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MCHR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MCHR1