MBD2 Antibody


Western Blot: MBD2 Antibody [NBP1-52894] - Lanes: Lane 1: 15 ug WT mouse ES lysate Lane 2: 15 ug MBD2 KO mouse ES lysate Primary Antibody Dilution: 1:1000 Secondary Antibody: Goat anti-rabbit-HRP Secondary Antibody ...read more
Immunohistochemistry: MBD2 Antibody [NBP1-52894] - Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Nucleus Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: ...read more
Western Blot: MBD2 Antibody [NBP1-52894] - HepG2 cell lysate, concentration 0.625ug/ml.

Product Details

Product Discontinued
View other related MBD2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MBD2 Antibody Summary

Synthetic peptides corresponding to MBD2 (methyl-CpG binding domain protein 2) The peptide sequence was selected from the middle region of MBD2. Peptide sequence DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against MBD2 and was validated on Western blot.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MBD2 Antibody

  • demethylase
  • DKFZp586O0821
  • DMTase
  • methyl-CpG binding domain protein 2
  • methyl-CpG-binding domain protein 2
  • Methyl-CpG-binding protein MBD2
  • NY-CO-41


MBD2 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD2 can also repress transcription from methylated gene promoters. MBD2 may function as a mediator of the biological consequences of the methylation signal.It is also reported that the MBD2 functions as a demethylase to activate transcription, as DNA methylation causes gene silencing.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. The protein encoded by this gene may function as a mediator of the biological consequences of the methylation signal. It is also reported that the this protein functions as a demethylase to activate transcription, as DNA methylation causes gene silencing.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC-P
Species: Hu
Applications: WB, ChIP, Flow, IHC-P, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
Species: Hu
Species: Hu, Mu
Applications: WB, IHC

Publications for MBD2 Antibody (NBP1-52894) (0)

There are no publications for MBD2 Antibody (NBP1-52894).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBD2 Antibody (NBP1-52894) (0)

There are no reviews for MBD2 Antibody (NBP1-52894). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MBD2 Antibody (NBP1-52894) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MBD2 Products

Bioinformatics Tool for MBD2 Antibody (NBP1-52894)

Discover related pathways, diseases and genes to MBD2 Antibody (NBP1-52894). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MBD2 Antibody (NBP1-52894)

Discover more about diseases related to MBD2 Antibody (NBP1-52894).

Pathways for MBD2 Antibody (NBP1-52894)

View related products by pathway.

PTMs for MBD2 Antibody (NBP1-52894)

Learn more about PTMs related to MBD2 Antibody (NBP1-52894).

Research Areas for MBD2 Antibody (NBP1-52894)

Find related products by research area.

Blogs on MBD2

There are no specific blogs for MBD2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MBD2 Antibody and receive a gift card or discount.


Gene Symbol MBD2