MBD1 Antibody (2C7)

Product Discontinued

MBD1 Antibody (2C7) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MBD1 (NP_056671 415 a.a. - 508 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE
• Specificity: MBD1 - methyl-CpG binding domain protein 1 (2C7)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MBD1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MBD1 Antibody (2C7)

• CXXC-type zinc finger protein 3
• methyl-CpG binding domain protein 1 isoform PCM1
• methyl-CpG binding domain protein 1
• methyl-CpG-binding domain protein 1
• Methyl-CpG-binding protein MBD1
• PCM1CXXC3RFT
• Protein containing methyl-CpG-binding domain 1
• the regulator of fibroblast growth factor 2 (FGF-2) transcription

Background

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MBD1
• Uniprot:
  • NP_056671(Human)