MBD1 Antibody (2B10)

Images

 
Sandwich ELISA: MBD1 Antibody (2B10) [H00004152-M05J] - Detection limit for recombinant GST tagged MBD1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related MBD1 Primary Antibodies

Order Details


    • Catalog Number
      H00004152-M05J
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MBD1 Antibody (2B10) Summary

Immunogen
MBD1 (NP_056671 415 a.a. - 508 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE
Specificity
MBD1 - methyl-CpG binding domain protein 1 (2B10)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MBD1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MBD1 Antibody (2B10)

  • CXXC-type zinc finger protein 3
  • methyl-CpG binding domain protein 1 isoform PCM1
  • methyl-CpG binding domain protein 1
  • methyl-CpG-binding domain protein 1
  • Methyl-CpG-binding protein MBD1
  • PCM1CXXC3RFT
  • Protein containing methyl-CpG-binding domain 1
  • the regulator of fibroblast growth factor 2 (FGF-2) transcription

Background

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-86304
Species: Hu
Applications: IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NB100-56534
Species: Hu
Applications: WB, IHC-P, ICC
NBP2-24393
Species: Hu
Applications: WB
NB100-56630
Species: Hu
Applications: WB
AF2988
Species: Mu, Rt
Applications: WB
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
H00004152-M05J
Species: Hu
Applications: WB, ELISA

Publications for MBD1 Antibody (H00004152-M05J) (0)

There are no publications for MBD1 Antibody (H00004152-M05J).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBD1 Antibody (H00004152-M05J) (0)

There are no reviews for MBD1 Antibody (H00004152-M05J). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MBD1 Antibody (H00004152-M05J) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MBD1 Products

Bioinformatics Tool for MBD1 Antibody (H00004152-M05J)

Discover related pathways, diseases and genes to MBD1 Antibody (H00004152-M05J). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MBD1 Antibody (H00004152-M05J)

Discover more about diseases related to MBD1 Antibody (H00004152-M05J).
 

Pathways for MBD1 Antibody (H00004152-M05J)

View related products by pathway.

PTMs for MBD1 Antibody (H00004152-M05J)

Learn more about PTMs related to MBD1 Antibody (H00004152-M05J).
 

Research Areas for MBD1 Antibody (H00004152-M05J)

Find related products by research area.

Blogs on MBD1

There are no specific blogs for MBD1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MBD1 Antibody (2B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol MBD1
Entrez
Uniprot