MAZ Antibody (3D2) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related MAZ Primary Antibodies

Order Details


    • Catalog Number
      H00004150-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MAZ Antibody (3D2) [PE] Summary

Immunogen
MAZ (NP_002374 332 a.a. - 440 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQ
Specificity
MAZ (3D2)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAZ
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAZ Antibody (3D2) [PE]

  • MAZI
  • MYC-associated zinc finger protein (purine-binding transcription factor)
  • myc-associated zinc finger protein
  • PUR1
  • Pur-1SAF-2
  • Purine-binding transcription factor
  • serum amyloid A activating factor 1
  • serum amyloid A activating factor 2
  • Transcription factor Zif87
  • ZF87SAF-1
  • Zif87
  • Zinc finger protein 801
  • zinc-finger protein, 87 kilodaltons
  • ZNF801SAF-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-00688
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-35213
Species: Hu
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for MAZ Antibody (H00004150-M01PE) (0)

There are no publications for MAZ Antibody (H00004150-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAZ Antibody (H00004150-M01PE) (0)

There are no reviews for MAZ Antibody (H00004150-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAZ Antibody (H00004150-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAZ Products

MAZ H00004150-M01PE

Bioinformatics Tool for MAZ Antibody (H00004150-M01PE)

Discover related pathways, diseases and genes to MAZ Antibody (H00004150-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAZ Antibody (H00004150-M01PE)

Discover more about diseases related to MAZ Antibody (H00004150-M01PE).
 

Pathways for MAZ Antibody (H00004150-M01PE)

View related products by pathway.

PTMs for MAZ Antibody (H00004150-M01PE)

Learn more about PTMs related to MAZ Antibody (H00004150-M01PE).

Blogs on MAZ

There are no specific blogs for MAZ, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAZ Antibody (3D2) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol MAZ