MASP2 Antibody


Western Blot: MASP2 Antibody [NBP1-69115] - Reccomended Titration: 1 ug/ml Sample Type: HeLa
Western Blot: MASP2 Antibody [NBP1-69115] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.

Product Details

Product Discontinued
View other related MASP2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MASP2 Antibody Summary

Synthetic peptides corresponding to Masp2 (mannan-binding lectin serine peptidase 2) The peptide sequence was selected from the middle region of Masp2. Peptide sequence YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Masp2 and was validated on Western blot.
Theoretical MW
75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MASP2 Antibody

  • EC 3.4.21
  • EC
  • mannan-binding lectin serine peptidase 1 pseudogene 1
  • mannan-binding lectin serine peptidase 2
  • mannan-binding lectin serine protease 1 pseudogene 1
  • mannan-binding lectin serine protease 2
  • Mannose-binding protein-associated serine protease 2
  • MAP19
  • MASP1P1
  • MASP-2
  • MBL-associated plasma protein of 19 kD
  • MBL-associated serine protease 2
  • small MBL-associated protein
  • sMAP


Masp2 is a serum protease that plays an important role in the activation of the complement system via mannose-binding lectin. After activation by auto-catalytic cleavage it cleaves C2 and C4, leading to their activation and to the formation of C3 convertase.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC

Publications for MASP2 Antibody (NBP1-69115) (0)

There are no publications for MASP2 Antibody (NBP1-69115).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MASP2 Antibody (NBP1-69115) (0)

There are no reviews for MASP2 Antibody (NBP1-69115). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MASP2 Antibody (NBP1-69115). (Showing 1 - 1 of 1 FAQ).

  1. We wish to measure MASP-2 levels in human plasma. Are stored plasma (or serum) at -20 centigrade stabile for this measurement if only frozen once. Should we measure in duplicate or triplicate? Is plasma better than serum as I have both stored for the MASP-2 test? What would be the cost of a kit and how many samples would it measure? I assume there is no special equipment other than ELISA like stuff? What is the shelf life as I have holiday next month? Is the a list of equipment we need to run the kits so I can check it with our lab technicians.
    • Once frozen samples should be fine for measurement. Generally, all experiments should be performed at least in triplicate so you can perform statistical analysis. MASP-2 should be detectable in both serum and plasma. Serum might yield cleaner signals since it is depleted of blood cells and clotting factors, but the depletion could, theoretically remove some MSAP-2 as well. Either type of sample should be suitable though. We currently have no MASP2 ELISA kits available. A list of our MASP2 antibodies can be found at this link if you would like to make your own. We guarantee all of our antibodies for 6 months from the receipt date.

Secondary Antibodies


Isotype Controls

Additional MASP2 Products

Bioinformatics Tool for MASP2 Antibody (NBP1-69115)

Discover related pathways, diseases and genes to MASP2 Antibody (NBP1-69115). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MASP2 Antibody (NBP1-69115)

Discover more about diseases related to MASP2 Antibody (NBP1-69115).

Pathways for MASP2 Antibody (NBP1-69115)

View related products by pathway.

PTMs for MASP2 Antibody (NBP1-69115)

Learn more about PTMs related to MASP2 Antibody (NBP1-69115).

Blogs on MASP2

There are no specific blogs for MASP2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MASP2 Antibody and receive a gift card or discount.


Gene Symbol MASP2