Mas Antibody

Images

 
Western Blot: Mas Antibody [NBP1-60090] - Sample Tissue: Human DLD1 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: Mas Antibody [NBP1-60090] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: Mas Antibody [NBP1-60090] - HepG2 tissue lysate at a concentration of 1.25ug/ml.

Product Details

Summary
Product Discontinued
View other related Mas Primary Antibodies

Order Details


    • Catalog Number
      NBP1-60090
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Mas Antibody Summary

Immunogen
Synthetic peptides corresponding to MAS1(MAS1 oncogene) The peptide sequence was selected from the middle region of MAS1. Peptide sequence RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI.
Clonality
Polyclonal
Host
Rabbit
Gene
MAS1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against MAS1 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Mas Antibody

  • Mas
  • MAS1 oncogene
  • MAS1
  • MGC119966
  • proto-oncogene Mas

Background

The structure of MAS1 indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.The structure of the MAS1 product indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12553
Species: Hu
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-45519
Species: Hu
Applications: WB, IHC
NBP1-47801
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50216
Species: Hu
Applications: WB, ELISA, IHC

Publications for Mas Antibody (NBP1-60090) (0)

There are no publications for Mas Antibody (NBP1-60090).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mas Antibody (NBP1-60090) (0)

There are no reviews for Mas Antibody (NBP1-60090). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mas Antibody (NBP1-60090) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mas Products

Bioinformatics Tool for Mas Antibody (NBP1-60090)

Discover related pathways, diseases and genes to Mas Antibody (NBP1-60090). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mas Antibody (NBP1-60090)

Discover more about diseases related to Mas Antibody (NBP1-60090).
 

Pathways for Mas Antibody (NBP1-60090)

View related products by pathway.

PTMs for Mas Antibody (NBP1-60090)

Learn more about PTMs related to Mas Antibody (NBP1-60090).
 

Research Areas for Mas Antibody (NBP1-60090)

Find related products by research area.

Blogs on Mas

There are no specific blogs for Mas, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mas Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAS1
Entrez
Uniprot