MANEA Antibody


Western Blot: MANEA Antibody [NBP1-69613] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: MANEA Antibody [NBP1-69613] - This Anti-MANEA antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.

Product Details

Product Discontinued
View other related MANEA Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MANEA Antibody Summary

Synthetic peptides corresponding to MANEA(mannosidase, endo-alpha) The peptide sequence was selected from the middle region of MANEA. Peptide sequence KVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MANEA and was validated on Western blot.
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MANEA Antibody

  • alpha 1,2-endomannosidase
  • DKFZp686D20120
  • EC 3.2.1
  • EC
  • ENDO
  • Endo-alpha mannosidase
  • endomannosidase
  • FLJ12838
  • glycoprotein endo-alpha-1,2-mannosidase
  • hEndo
  • mandaselin
  • mannosidase, endo-alpha


N-glycosylation of proteins is initiated in the endoplasmic reticulum (ER) by the transfer of the preassembled oligosaccharide glucose-3-mannose-9-N-acetylglucosamine-2 from dolichyl pyrophosphate to acceptor sites on the target protein by an oligosaccharyltransferase complex. This core oligosaccharide is sequentially processed by several ER glycosidases and by an endomannosidase (E.C., such as MANEA, in the Golgi. MANEA catalyzes the release of mono-, di-, and triglucosylmannose oligosaccharides by cleaving the alpha-1,2-mannosidic bond that links them to high-mannose glycans.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB

Publications for MANEA Antibody (NBP1-69613) (0)

There are no publications for MANEA Antibody (NBP1-69613).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MANEA Antibody (NBP1-69613) (0)

There are no reviews for MANEA Antibody (NBP1-69613). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MANEA Antibody (NBP1-69613) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MANEA Products

Bioinformatics Tool for MANEA Antibody (NBP1-69613)

Discover related pathways, diseases and genes to MANEA Antibody (NBP1-69613). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MANEA Antibody (NBP1-69613)

Discover more about diseases related to MANEA Antibody (NBP1-69613).

Pathways for MANEA Antibody (NBP1-69613)

View related products by pathway.

Research Areas for MANEA Antibody (NBP1-69613)

Find related products by research area.

Blogs on MANEA

There are no specific blogs for MANEA, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MANEA Antibody and receive a gift card or discount.


Gene Symbol MANEA