MAK3 Antibody

Images

 
Western Blot: MAK3 Antibody [NBP1-70631] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAK3 Antibody Summary

Immunogen
Synthetic peptides corresponding to NAT12(N-acetyltransferase 12) The peptide sequence was selected from the middle region of NAT12 (NP_001011713). Peptide sequence EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAA30
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against NAT12 and was validated on Western blot. Use in Immunohistochemistry reported in scientific literature (PMID26292663)
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-70631 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MAK3 Antibody

  • MAK3
  • MGC141884
  • N(alpha)-acetyltransferase 30, NatC catalytic subunit
  • N-acetyltransferase MAK3 homolog
  • N-alpha-acetyltransferase 30, NatC catalytic subunit
  • putative)

Background

NAT12 belongs to the acetyltransferase family, MAK3 subfamily. It contains 1 N-acetyltransferase domain. It is a probable N-acetyltransferase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90032
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
H00057538-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00004117-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-21387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
24790002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-60103
Species: Hu
Applications: WB, IHC
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP1-74258
Species: Hu
Applications: WB
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81010
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-19461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-70631
Species: Hu
Applications: WB, IHC

Publications for MAK3 Antibody (NBP1-70631)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MAK3 Antibody (NBP1-70631) (0)

There are no reviews for MAK3 Antibody (NBP1-70631). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAK3 Antibody (NBP1-70631) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAK3 Products

MAK3 NBP1-70631

Bioinformatics Tool for MAK3 Antibody (NBP1-70631)

Discover related pathways, diseases and genes to MAK3 Antibody (NBP1-70631). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for MAK3 Antibody (NBP1-70631)

View related products by pathway.

PTMs for MAK3 Antibody (NBP1-70631)

Learn more about PTMs related to MAK3 Antibody (NBP1-70631).

Blogs on MAK3

There are no specific blogs for MAK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAK3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAA30
Entrez
Uniprot