Recombinant Human MAGP-2/MFAP5 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related MAGP-2/MFAP5 Peptides and Proteins

Order Details


    • Catalog Number
      H00008076-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human MAGP-2/MFAP5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-173 of Human MFAP5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
MFAP5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAGP-2/MFAP5 Protein

  • MAGP2
  • MAGP-2
  • MAGP2MFAP-5
  • MFAP5
  • Microfibril-associated glycoprotein 2
  • microfibrillar associated protein 5
  • microfibrillar-associated protein 5
  • MP25
  • MP25microfibril-associated glycoprotein-2

Background

This gene encodes a 25-kD microfibril-associated glycoprotein which is rich in serine and threonine residues. It lacks a hydrophobic carboxyl terminus and proline-, glutamine-, and tyrosine-rich regions, which are characteristics of a related 31-kDa microfibril-associated glycoprotein (MFAP2). The close similarity between these two proteins is confined to a central region of 60 aa where precise alignment of 7 cysteine residues occurs. The structural differences suggest that this encoded protein has some functions that are distinct from those of MFAP2. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4977
Species: Mu
Applications: WB
NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-33479
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58529
Species: Hu
Applications: ICC/IF
AF2846
Species: Hu
Applications: WB, IHC
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-13382
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008076-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for MAGP-2/MFAP5 Recombinant Protein (H00008076-P01) (0)

There are no publications for MAGP-2/MFAP5 Recombinant Protein (H00008076-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGP-2/MFAP5 Recombinant Protein (H00008076-P01) (0)

There are no reviews for MAGP-2/MFAP5 Recombinant Protein (H00008076-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGP-2/MFAP5 Recombinant Protein (H00008076-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAGP-2/MFAP5 Products

Bioinformatics Tool for MAGP-2/MFAP5 Recombinant Protein (H00008076-P01)

Discover related pathways, diseases and genes to MAGP-2/MFAP5 Recombinant Protein (H00008076-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGP-2/MFAP5 Recombinant Protein (H00008076-P01)

Discover more about diseases related to MAGP-2/MFAP5 Recombinant Protein (H00008076-P01).
 

Pathways for MAGP-2/MFAP5 Recombinant Protein (H00008076-P01)

View related products by pathway.

Blogs on MAGP-2/MFAP5

There are no specific blogs for MAGP-2/MFAP5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAGP-2/MFAP5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MFAP5
Entrez