MAGEB4 Antibody

Images

 
Western Blot: MAGEB4 Antibody [NBP1-57758] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related MAGEB4 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-57758
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MAGEB4 Antibody Summary

Immunogen
Synthetic peptides corresponding to MAGEB4 (melanoma antigen family B, 4) The peptide sequence was selected from the N terminal of MAGEB4)(50ug). Peptide sequence KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGD.
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEB4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MAGEB4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MAGEB4 Antibody

  • cancer/testis antigen family 3, member 6
  • CT3.6
  • MAGE-B4 antigen
  • melanoma antigen family B, 4
  • melanoma-associated antigen B4
  • MGC33144

Background

This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEB genes are clustered on chromosome Xp22-p21. This gene sequence ends in the first intron of MAGEB1, another family member. This gene is expressed in testis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-29469
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1725
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF4409
Species: Mu
Applications: WB
MAB38352
Species: Hu, Mu
Applications: WB, ICC
NBP1-85406
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02553
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP2-45722
Species: Hu
Applications: WB, IHC
NBP2-31913
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-57758
Species: Hu
Applications: WB

Publications for MAGEB4 Antibody (NBP1-57758) (0)

There are no publications for MAGEB4 Antibody (NBP1-57758).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEB4 Antibody (NBP1-57758) (0)

There are no reviews for MAGEB4 Antibody (NBP1-57758). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGEB4 Antibody (NBP1-57758) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGEB4 Products

Bioinformatics Tool for MAGEB4 Antibody (NBP1-57758)

Discover related pathways, diseases and genes to MAGEB4 Antibody (NBP1-57758). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEB4 Antibody (NBP1-57758)

Discover more about diseases related to MAGEB4 Antibody (NBP1-57758).
 

Pathways for MAGEB4 Antibody (NBP1-57758)

View related products by pathway.

PTMs for MAGEB4 Antibody (NBP1-57758)

Learn more about PTMs related to MAGEB4 Antibody (NBP1-57758).

Blogs on MAGEB4

There are no specific blogs for MAGEB4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGEB4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEB4
Uniprot