MAGEB4 Antibody



Product Details

Product Discontinued
View other related MAGEB4 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MAGEB4 Antibody Summary

Synthetic peptides corresponding to MAGEB4 (melanoma antigen family B, 4) The peptide sequence was selected from the N terminal of MAGEB4)(50ug). Peptide sequence KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGD.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against MAGEB4 and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.


This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEB genes are clustered on chromosome Xp22-p21. This gene sequence ends in the first intron of MAGEB1, another family member. This gene is expressed in testis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Ca, Op, Pm
Applications: WB, IHC-P
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, In vitro
Species: Hu
Applications: WB

Publications for MAGEB4 Antibody (NBP1-57758) (0)

There are no publications for MAGEB4 Antibody (NBP1-57758).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEB4 Antibody (NBP1-57758) (0)

There are no reviews for MAGEB4 Antibody (NBP1-57758). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for MAGEB4 Antibody (NBP1-57758) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAGEB4 Antibody Products

Related Products by Gene

Bioinformatics Tool for MAGEB4 Antibody (NBP1-57758)

Discover related pathways, diseases and genes to MAGEB4 Antibody (NBP1-57758). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEB4 Antibody (NBP1-57758)

Discover more about diseases related to MAGEB4 Antibody (NBP1-57758).

Pathways for MAGEB4 Antibody (NBP1-57758)

View related products by pathway.

PTMs for MAGEB4 Antibody (NBP1-57758)

Learn more about PTMs related to MAGEB4 Antibody (NBP1-57758).

Blogs on MAGEB4

There are no specific blogs for MAGEB4, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol MAGEB4

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-57758 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.