MAGEB18 Antibody

Images

 
Western Blot: MAGEB18 Antibody [NBP2-14212] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: MAGEB18 Antibody [NBP2-14212] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAGEB18 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IRKDKCHFNEILKRASEHMELALGVDLKEVDPIRHYYAFFSKLDLTYDET TSDEEKIPKTGLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEB18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MAGEB18 Protein (NBP2-14212PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAGEB18 Antibody

  • MAGE-B18 antigen
  • melanoma antigen family B, 18
  • melanoma-associated antigen B18
  • MGC33889

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-14212
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MAGEB18 Antibody (NBP2-14212) (0)

There are no publications for MAGEB18 Antibody (NBP2-14212).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEB18 Antibody (NBP2-14212) (0)

There are no reviews for MAGEB18 Antibody (NBP2-14212). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGEB18 Antibody (NBP2-14212) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGEB18 Products

Bioinformatics Tool for MAGEB18 Antibody (NBP2-14212)

Discover related pathways, diseases and genes to MAGEB18 Antibody (NBP2-14212). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEB18 Antibody (NBP2-14212)

Discover more about diseases related to MAGEB18 Antibody (NBP2-14212).
 

Pathways for MAGEB18 Antibody (NBP2-14212)

View related products by pathway.

PTMs for MAGEB18 Antibody (NBP2-14212)

Learn more about PTMs related to MAGEB18 Antibody (NBP2-14212).

Blogs on MAGEB18

There are no specific blogs for MAGEB18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGEB18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEB18