MAGEA4 Antibody

Images

 
Western Blot: MAGEA4 Antibody [NBP1-56755] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: MAGEA4 Antibody [NBP1-56755] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: MAGEA4 Antibody [NBP1-56755] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: MAGEA4 Antibody [NBP1-56755] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Product Discontinued
View other related MAGEA4 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-56755
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MAGEA4 Antibody Summary

Immunogen
Synthetic peptides corresponding to MAGEA4(melanoma antigen family A, 4) The peptide sequence was selected from the C terminal of MAGEA4. Peptide sequence ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP.
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MAGEA4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MAGEA4 Antibody

  • MAGE-X2 antigen
  • melanoma antigen family A, 4
  • melanoma-associated antigen 4
  • member 4

Background

MAGEA4 is a member of the MAGEA family. The members of this family are proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. At least four variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45719
Species: Hu
Applications: WB, IHC
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29469
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-56603
Species: Hu
Applications: WB
NBP1-02553
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-85397
Species: Hu
Applications: IHC, IHC-P
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00004111-M01
Species: Hu, Mu
Applications: WB, ELISA
H00002543-T01
Species: Hu
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-56755
Species: Hu
Applications: WB

Publications for MAGEA4 Antibody (NBP1-56755) (0)

There are no publications for MAGEA4 Antibody (NBP1-56755).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEA4 Antibody (NBP1-56755) (0)

There are no reviews for MAGEA4 Antibody (NBP1-56755). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGEA4 Antibody (NBP1-56755) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGEA4 Products

Bioinformatics Tool for MAGEA4 Antibody (NBP1-56755)

Discover related pathways, diseases and genes to MAGEA4 Antibody (NBP1-56755). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEA4 Antibody (NBP1-56755)

Discover more about diseases related to MAGEA4 Antibody (NBP1-56755).
 

Pathways for MAGEA4 Antibody (NBP1-56755)

View related products by pathway.

PTMs for MAGEA4 Antibody (NBP1-56755)

Learn more about PTMs related to MAGEA4 Antibody (NBP1-56755).
 

Research Areas for MAGEA4 Antibody (NBP1-56755)

Find related products by research area.

Blogs on MAGEA4

There are no specific blogs for MAGEA4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGEA4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEA4
Uniprot