Macrophage Inflammatory Protein 1 alpha Antibody

Images

 
Western Blot: Macrophage Inflammatory Protein 1 alpha Antibody [H00006348-B01P] - Analysis of CCL3 expression in transfected 293T cell line by CCL3 polyclonal antibody. Lane 1: CCL3 transfected lysate(10.12 KDa). Lane ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Macrophage Inflammatory Protein 1 alpha Antibody Summary

Immunogen
CCL3 (NP_002974, 1 a.a. - 92 a.a.) full-length human protein. MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CCL3
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Macrophage Inflammatory Protein 1 alpha Antibody

  • C-C motif chemokine 3
  • chemokine (C-C motif) ligand 3
  • G0S19-1Tonsillar lymphocyte LD78 alpha protein
  • LD78ALPHA
  • Macrophage inflammatory protein 1-alpha
  • MIP1AG0/G1 switch regulatory protein 19-1
  • MIP-1-alphaSIS-beta
  • SCYA3PAT 464.1
  • small inducible cytokine A3 (homologous to mouse Mip-1a)
  • Small-inducible cytokine A3

Background

MIP1 alpha belongs to the chemokine beta family. In vitro MIP1 alpha stimulates H2O2 production in human neutrophils. MIP1 alpha and MIP1 beta, two closely related but distinct proteins, were originally co-purified from medium conditioned by a LPS-stimulated murine macrophage cell line. Mature mouse MIP1 alpha shares approximately 77% and 70% amino acid identity with human MIP1 alpha and mouse MIP1 beta, respectively. MIP1 proteins are expressed primarily in T cells, B cells, and monocytes after antigen or mitogen stimulation. Has adhesive effects on lymphocytes. MIP1 alpha can inhibit the proliferation of hematopoietic stem cells in vitro as well as in vivo. A signal transducing receptor, designated the C-C chemokine receptor 1 (C-C CKR-1) with seven transmembrane domains that bind MIP1 alpha, MIP1 beta, MCP1 and RANTES with varying affinities, has been isolated.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
MAB145
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-48337
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P) (0)

There are no publications for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P) (0)

There are no reviews for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Macrophage Inflammatory Protein 1 alpha Products

Bioinformatics Tool for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P)

Discover related pathways, diseases and genes to Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P)

Discover more about diseases related to Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P).
 

Pathways for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P)

View related products by pathway.

PTMs for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P)

Learn more about PTMs related to Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P).
 

Research Areas for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-B01P)

Find related products by research area.

Blogs on Macrophage Inflammatory Protein 1 alpha

There are no specific blogs for Macrophage Inflammatory Protein 1 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Macrophage Inflammatory Protein 1 alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCL3
Uniprot