MACROD2 Antibody

Images

 
Western Blot: MACROD2 Antibody [NBP2-31036] - Analysis in human cell line EFO-21.
Immunohistochemistry: MACROD2 Antibody [NBP2-31036] - Staining of human kidney shows distinct nuclear positivity in cells in tubules.
Western Blot: MACROD2 Antibody [NBP2-31036] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Product Discontinued
View other related MACROD2 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-31036
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MACROD2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MYPSNKKKKVWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDEENTQETSQVKKSLTE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MACROD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MACROD2 Antibody

  • [Protein ADP-Ribosylglutamate] Hydrolase
  • C20orf133
  • C2orf133
  • Chromosome 20 Open Reading Frame 133
  • EC 3.2.2
  • EC 3.5.1
  • MACRO Domain Containing 2
  • MACRO Domain-Containing Protein 2
  • O-Acetyl-ADP-Ribose Deacetylase MACROD2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF2795
Species: Hu
Applications: WB
NBP1-83242
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13169
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-2462
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, PEP-ELISA
AF4237
Species: Mu
Applications: WB, IHC
AF6590
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-81788
Species: Hu
Applications: IHC, IHC-P
NBP1-33737
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32343
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-80813
Species: Hu
Applications: IHC, IHC-P
AF5480
Species: Hu
Applications: IHC
NLS139
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32539
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00002020-M03
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90443
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-57521
Species: Hu, Mu
Applications: WB, IP
AF5269
Species: Hu, Mu
Applications: WB, IHC

Publications for MACROD2 Antibody (NBP2-31036) (0)

There are no publications for MACROD2 Antibody (NBP2-31036).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MACROD2 Antibody (NBP2-31036) (0)

There are no reviews for MACROD2 Antibody (NBP2-31036). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MACROD2 Antibody (NBP2-31036) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Bioinformatics Tool for MACROD2 Antibody (NBP2-31036)

Discover related pathways, diseases and genes to MACROD2 Antibody (NBP2-31036). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MACROD2 Antibody (NBP2-31036)

Discover more about diseases related to MACROD2 Antibody (NBP2-31036).
 

Pathways for MACROD2 Antibody (NBP2-31036)

View related products by pathway.

Blogs on MACROD2

There are no specific blogs for MACROD2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MACROD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MACROD2
Uniprot