M-CSF R/CD115 Antibody

Images

 
Western Blot: M-CSF R/CD115 Antibody [NBP1-84532] - Analysis in human cell line BEWO.
Immunocytochemistry/ Immunofluorescence: M-CSF R/CD115 Antibody [NBP1-84532] - Staining of human cell line A-431 shows localization to plasma membrane & vesicles.
Immunohistochemistry-Paraffin: M-CSF R/CD115 Antibody [NBP1-84532] - Staining of human hippocampus shows cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

M-CSF R/CD115 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSF1R
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
M-CSF R/CD115 Protein (NBP1-84532PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for M-CSF R/CD115 Antibody

  • CD115 antigen
  • CD115
  • c-fms
  • colony stimulating factor 1 receptor
  • CSF1R
  • CSF-1-R
  • CSFR
  • EC 2.7.10.1
  • FMS proto-oncogene
  • FMSFIM2
  • macrophage colony stimulating factor I receptor
  • macrophage colony-stimulating factor 1 receptor
  • McDonough feline sarcoma viral (v-fms) oncogene homolog
  • M-CSF R
  • MCSFR
  • M-CSFR
  • Proto-oncogene c-Fms

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

416-ML/CF
Species: Mu
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84532
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for M-CSF R/CD115 Antibody (NBP1-84532) (0)

There are no publications for M-CSF R/CD115 Antibody (NBP1-84532).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for M-CSF R/CD115 Antibody (NBP1-84532) (0)

There are no reviews for M-CSF R/CD115 Antibody (NBP1-84532). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for M-CSF R/CD115 Antibody (NBP1-84532) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional M-CSF R/CD115 Products

Bioinformatics Tool for M-CSF R/CD115 Antibody (NBP1-84532)

Discover related pathways, diseases and genes to M-CSF R/CD115 Antibody (NBP1-84532). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for M-CSF R/CD115 Antibody (NBP1-84532)

Discover more about diseases related to M-CSF R/CD115 Antibody (NBP1-84532).
 

Pathways for M-CSF R/CD115 Antibody (NBP1-84532)

View related products by pathway.

PTMs for M-CSF R/CD115 Antibody (NBP1-84532)

Learn more about PTMs related to M-CSF R/CD115 Antibody (NBP1-84532).

Blogs on M-CSF R/CD115

There are no specific blogs for M-CSF R/CD115, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our M-CSF R/CD115 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSF1R
Entrez
Uniprot