M-CSF R/CD115 Antibody (3G12)

Images

 
Western Blot: M-CSF R Antibody (3G12) [H00001436-M02] - CSF1R monoclonal antibody (M02), clone 3G12 Analysis of CSF1R expression in Hela S3 NE.
Proximity Ligation Assay: M-CSF R Antibody (3G12) [H00001436-M02] - Analysis of protein-protein interactions between PIK3R1 and CSF1R. HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and ...read more
Sandwich ELISA: M-CSF R Antibody (3G12) [H00001436-M02] - Detection limit for recombinant GST tagged CSF1R is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA
Clone
3G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

M-CSF R/CD115 Antibody (3G12) Summary

Immunogen
CSF1R (AAH47521, 21 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
Specificity
CSF1R (3G12)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CSF1R
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for M-CSF R/CD115 Antibody (3G12)

  • CD115 antigen
  • CD115
  • c-fms
  • colony stimulating factor 1 receptor
  • CSF1R
  • CSF-1-R
  • CSFR
  • EC 2.7.10.1
  • FMS proto-oncogene
  • FMSFIM2
  • macrophage colony stimulating factor I receptor
  • macrophage colony-stimulating factor 1 receptor
  • McDonough feline sarcoma viral (v-fms) oncogene homolog
  • M-CSF R
  • MCSFR
  • M-CSFR
  • Proto-oncogene c-Fms

Background

The protein encoded by this gene is the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. This receptor mediates most if not all of the biological effects of this cytokine. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. The encoded protein is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. Mutations in this gene have been associated with a predisposition to myeloid malignancy. The first intron of this gene contains a transcriptionally inactive ribosomal protein L7 processed pseudogene oriented in the opposite direction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

416-ML/CF
Species: Mu
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
H00001436-M02
Species: Hu
Applications: WB, ELISA, PLA

Publications for M-CSF R/CD115 Antibody (H00001436-M02) (0)

There are no publications for M-CSF R/CD115 Antibody (H00001436-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for M-CSF R/CD115 Antibody (H00001436-M02) (0)

There are no reviews for M-CSF R/CD115 Antibody (H00001436-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for M-CSF R/CD115 Antibody (H00001436-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional M-CSF R/CD115 Products

Bioinformatics Tool for M-CSF R/CD115 Antibody (H00001436-M02)

Discover related pathways, diseases and genes to M-CSF R/CD115 Antibody (H00001436-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for M-CSF R/CD115 Antibody (H00001436-M02)

Discover more about diseases related to M-CSF R/CD115 Antibody (H00001436-M02).
 

Pathways for M-CSF R/CD115 Antibody (H00001436-M02)

View related products by pathway.

PTMs for M-CSF R/CD115 Antibody (H00001436-M02)

Learn more about PTMs related to M-CSF R/CD115 Antibody (H00001436-M02).
 

Research Areas for M-CSF R/CD115 Antibody (H00001436-M02)

Find related products by research area.

Blogs on M-CSF R/CD115

There are no specific blogs for M-CSF R/CD115, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our M-CSF R/CD115 Antibody (3G12) and receive a gift card or discount.

Bioinformatics

Gene Symbol CSF1R
Entrez
OMIM
Uniprot