M-CSF Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

M-CSF Partial Recombinant Protein Summary

Description
M-CSF (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDK
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Gene
CSF1

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for M-CSF Partial Recombinant Protein

  • colony stimulating factor 1 (macrophage)
  • CSF1
  • CSF-1
  • Lanimostim
  • macrophage colony stimulating factor
  • macrophage colony-stimulating factor 1
  • MCSF
  • M-CSF
  • MCSFlanimostim
  • MGC31930

Background

CSF1 - colony stimulating factor 1 (macrophage)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37292
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
MAB214R
Species: Hu
Applications: ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, Flow-CS
H00001435-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for M-CSF Partial Recombinant Protein (H00001435-Q01) (0)

There are no publications for M-CSF Partial Recombinant Protein (H00001435-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for M-CSF Partial Recombinant Protein (H00001435-Q01) (0)

There are no reviews for M-CSF Partial Recombinant Protein (H00001435-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for M-CSF Partial Recombinant Protein (H00001435-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional M-CSF Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for M-CSF Partial Recombinant Protein (H00001435-Q01)

Discover related pathways, diseases and genes to M-CSF Partial Recombinant Protein (H00001435-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for M-CSF Partial Recombinant Protein (H00001435-Q01)

Discover more about diseases related to M-CSF Partial Recombinant Protein (H00001435-Q01).
 

Pathways for M-CSF Partial Recombinant Protein (H00001435-Q01)

View related products by pathway.

PTMs for M-CSF Partial Recombinant Protein (H00001435-Q01)

Learn more about PTMs related to M-CSF Partial Recombinant Protein (H00001435-Q01).
 

Research Areas for M-CSF Partial Recombinant Protein (H00001435-Q01)

Find related products by research area.

Blogs on M-CSF

There are no specific blogs for M-CSF, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our M-CSF Partial Recombinant Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CSF1
Entrez
Uniprot

Customers Who Bought This Also Bought

Human M-CSF Protein
NBP2-34975-2ug