M-CSF Antibody (1A9)

Images

 
Western Blot: M-CSF Antibody (1A9) [H00001435-M01] - Analysis of CSF1 expression in transfected 293T cell line by CSF1 monoclonal antibody (M01), clone 1A9.Lane 1: CSF1 transfected lysate(60.1 KDa).Lane 2: ...read more
Sandwich ELISA: M-CSF Antibody (1A9) [H00001435-M01] - Detection limit for recombinant GST tagged CSF1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

M-CSF Antibody (1A9) Summary

Immunogen
CSF1 (AAH21117, 33 a.a. - 132 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDK
Localization
Secreted
Specificity
CSF1 - colony stimulating factor 1 (macrophage)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CSF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.
Publications
Read Publications using H00001435-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for M-CSF Antibody (1A9)

  • colony stimulating factor 1 (macrophage)
  • CSF1
  • CSF-1
  • Lanimostim
  • macrophage colony stimulating factor
  • macrophage colony-stimulating factor 1
  • MCSF
  • M-CSF
  • MCSFlanimostim
  • MGC31930

Background

The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37292
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS

Publications for M-CSF Antibody (H00001435-M01)(2)

Reviews for M-CSF Antibody (H00001435-M01) (0)

There are no reviews for M-CSF Antibody (H00001435-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for M-CSF Antibody (H00001435-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional M-CSF Products

Bioinformatics Tool for M-CSF Antibody (H00001435-M01)

Discover related pathways, diseases and genes to M-CSF Antibody (H00001435-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for M-CSF Antibody (H00001435-M01)

Discover more about diseases related to M-CSF Antibody (H00001435-M01).
 

Pathways for M-CSF Antibody (H00001435-M01)

View related products by pathway.

PTMs for M-CSF Antibody (H00001435-M01)

Learn more about PTMs related to M-CSF Antibody (H00001435-M01).
 

Research Areas for M-CSF Antibody (H00001435-M01)

Find related products by research area.

Blogs on M-CSF

There are no specific blogs for M-CSF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our M-CSF Antibody (1A9) and receive a gift card or discount.

Bioinformatics

Gene Symbol CSF1
Entrez
OMIM
Uniprot