Recombinant Human LZTS1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LZTS1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 514-596 of Human LZTS1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ERQGHDQMSSGFQHERLVWKEEKEKVIQYQKQLQQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
LZTS1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LZTS1 Protein

  • F37
  • F37/esophageal cancer-related gene-coding leucine-zipper motifFez1
  • FEZ1leucine zipper putative tumor suppressor 1
  • leucine zipper, putative tumor suppressor 1

Background

LZTS1 - leucine zipper, putative tumor suppressor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01086
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB7557
Species: Hu
Applications: WB, IHC
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4366
Species: Hu, Mu, Rt
Applications: WB
NBL1-10680
Species: Hu
NBP2-01171
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90909
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89062
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-61071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
H00011178-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for LZTS1 Partial Recombinant Protein (H00011178-Q01) (0)

There are no publications for LZTS1 Partial Recombinant Protein (H00011178-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LZTS1 Partial Recombinant Protein (H00011178-Q01) (0)

There are no reviews for LZTS1 Partial Recombinant Protein (H00011178-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LZTS1 Partial Recombinant Protein (H00011178-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LZTS1 Products

Bioinformatics Tool for LZTS1 Partial Recombinant Protein (H00011178-Q01)

Discover related pathways, diseases and genes to LZTS1 Partial Recombinant Protein (H00011178-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LZTS1 Partial Recombinant Protein (H00011178-Q01)

Discover more about diseases related to LZTS1 Partial Recombinant Protein (H00011178-Q01).
 

Pathways for LZTS1 Partial Recombinant Protein (H00011178-Q01)

View related products by pathway.

PTMs for LZTS1 Partial Recombinant Protein (H00011178-Q01)

Learn more about PTMs related to LZTS1 Partial Recombinant Protein (H00011178-Q01).
 

Research Areas for LZTS1 Partial Recombinant Protein (H00011178-Q01)

Find related products by research area.

Blogs on LZTS1

There are no specific blogs for LZTS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LZTS1 Antibody
NBP1-83908

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LZTS1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LZTS1