Recombinant Human LYZL2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LYZL2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 194 of Human LYZL2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSDWKKDCEVS

Protein/Peptide Type
Recombinant Protein
Gene
LYZL2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LYZL2 Protein

  • EC 3.2.1.17
  • lysozyme 2
  • lysozyme-2
  • lysozyme-like 2
  • lysozyme-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89136
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-81029
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3049
Species: Hu
Applications: WB, IHC
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-02984
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13659
Species: Hu
Applications: IHC, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-81279
Species: Hu
Applications: WB, IHC, IHC-P
AF7970
Species: Mu
Applications: WB
NB100-2475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-31116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88809
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00119180-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for LYZL2 Recombinant Protein (H00119180-P01) (0)

There are no publications for LYZL2 Recombinant Protein (H00119180-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYZL2 Recombinant Protein (H00119180-P01) (0)

There are no reviews for LYZL2 Recombinant Protein (H00119180-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYZL2 Recombinant Protein (H00119180-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LYZL2 Products

Bioinformatics Tool for LYZL2 Recombinant Protein (H00119180-P01)

Discover related pathways, diseases and genes to LYZL2 Recombinant Protein (H00119180-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LYZL2 Recombinant Protein (H00119180-P01)

Discover more about diseases related to LYZL2 Recombinant Protein (H00119180-P01).

Blogs on LYZL2

There are no specific blogs for LYZL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LYZL2 Antibody
H00119180-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LYZL2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LYZL2