LYZL1 Antibody


Western Blot: LYZL1 Antibody [NBP2-86704] - Host: Rabbit. Target Name: LYZL1. Sample Tissue: Mouse Mouse Skeletal Muscle lysates. Antibody Dilution: 1ug/ml

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

LYZL1 Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of mouse LYZL1. Peptide sequence: ARKHQKNHCHVACSALITDDLTDAILCAKKIVKETQGMNYWQGWKKNCEN The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for LYZL1 Antibody

  • EC
  • KAAG648
  • LYC2bA534G20.1
  • lysozyme-like 1
  • lysozyme-like protein 1
  • MGC33408
  • PRO1278


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB

Publications for LYZL1 Antibody (NBP2-86704) (0)

There are no publications for LYZL1 Antibody (NBP2-86704).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYZL1 Antibody (NBP2-86704) (0)

There are no reviews for LYZL1 Antibody (NBP2-86704). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYZL1 Antibody (NBP2-86704) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional LYZL1 Products

Bioinformatics Tool for LYZL1 Antibody (NBP2-86704)

Discover related pathways, diseases and genes to LYZL1 Antibody (NBP2-86704). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for LYZL1 Antibody (NBP2-86704)

Find related products by research area.

Blogs on LYZL1

There are no specific blogs for LYZL1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LYZL1 Antibody and receive a gift card or discount.


Gene Symbol LYZL1