Lysyl Oxidase Homolog 3/LOXL3 Antibody

Images

 
Immunohistochemistry-Paraffin: Lysyl Oxidase Homolog 3/LOXL3 Antibody [NBP1-85908] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Lysyl Oxidase Homolog 3/LOXL3 Antibody [NBP1-85908] - Staining of human kidney shows cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Lysyl Oxidase Homolog 3/LOXL3 Antibody [NBP1-85908] - Staining of human placenta shows cytoplasmic positivity in decidual cells.
Immunohistochemistry-Paraffin: Lysyl Oxidase Homolog 3/LOXL3 Antibody [NBP1-85908] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Lysyl Oxidase Homolog 3/LOXL3 Antibody [NBP1-85908] - Staining in human placenta and skeletal muscle tissues. Corresponding LOXL3 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Lysyl Oxidase Homolog 3/LOXL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KRVNAAFYRLLAQRQQHSFGLHGVACVGTEAHLSLCSLEFYRANDTARCP
Specificity
Specificity of human Lysyl Oxidase Homolog 3/LOXL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LOXL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Lysyl Oxidase Homolog 3/LOXL3 Protein (NBP1-85908PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lysyl Oxidase Homolog 3/LOXL3 Antibody

  • EC 1.4.3
  • EC 1.4.3.-
  • EC 1.4.3.13
  • LOL3
  • LOXL
  • LOXL3
  • Lysyl Oxidase Homolog 3
  • lysyl oxidase-like 3
  • Lysyl oxidase-like protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-32954
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
H00084171-M01
Species: Hu
Applications: WB, ELISA
NBP1-82827
Species: Hu
Applications: IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00051497-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF1458
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
MAB41281
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-67451
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
46780002
Species: Hu
Applications: ELISA

Publications for Lysyl Oxidase Homolog 3/LOXL3 Antibody (NBP1-85908) (0)

There are no publications for Lysyl Oxidase Homolog 3/LOXL3 Antibody (NBP1-85908).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lysyl Oxidase Homolog 3/LOXL3 Antibody (NBP1-85908) (0)

There are no reviews for Lysyl Oxidase Homolog 3/LOXL3 Antibody (NBP1-85908). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lysyl Oxidase Homolog 3/LOXL3 Antibody (NBP1-85908) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lysyl Oxidase Homolog 3/LOXL3 Products

Bioinformatics Tool for Lysyl Oxidase Homolog 3/LOXL3 Antibody (NBP1-85908)

Discover related pathways, diseases and genes to Lysyl Oxidase Homolog 3/LOXL3 Antibody (NBP1-85908). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lysyl Oxidase Homolog 3/LOXL3 Antibody (NBP1-85908)

Discover more about diseases related to Lysyl Oxidase Homolog 3/LOXL3 Antibody (NBP1-85908).
 

Pathways for Lysyl Oxidase Homolog 3/LOXL3 Antibody (NBP1-85908)

View related products by pathway.

PTMs for Lysyl Oxidase Homolog 3/LOXL3 Antibody (NBP1-85908)

Learn more about PTMs related to Lysyl Oxidase Homolog 3/LOXL3 Antibody (NBP1-85908).
 

Research Areas for Lysyl Oxidase Homolog 3/LOXL3 Antibody (NBP1-85908)

Find related products by research area.

Blogs on Lysyl Oxidase Homolog 3/LOXL3

There are no specific blogs for Lysyl Oxidase Homolog 3/LOXL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lysyl Oxidase Homolog 3/LOXL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LOXL3
Entrez