Recombinant Human Lysyl Oxidase Homolog 2/LOXL2 Protein

Images

 
SDS-Page: Recombinant Human Lysyl Oxidase Homolog 2/LOXL2 Protein [H00004017-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Lysyl Oxidase Homolog 2/LOXL2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 675 - 773 of Human LOXL2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP

Protein/Peptide Type
Partial Recombinant Protein
Gene
LOXL2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Lysyl Oxidase Homolog 2/LOXL2 Protein

  • EC 1.4.3
  • EC 1.4.3.-
  • LOL2
  • LOR2
  • LOXL2
  • Lysyl Oxidase Homolog 2
  • lysyl oxidase related 2
  • lysyl oxidase-like 2
  • Lysyl oxidase-like protein 2
  • Lysyl oxidase-related protein 2
  • Lysyl oxidase-related protein WS9-14
  • WS9-14

Background

LOXL2 - lysyl oxidase-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00084695-A01
Species: Hu
Applications: WB, ELISA
NBP1-82827
Species: Hu
Applications: IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
H00084171-M01
Species: Hu
Applications: WB, ELISA
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-27184
Species: Hu, Mu, Ca, Eq
Applications: WB, ICC/IF
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P

Publications for Lysyl Oxidase Homolog 2/LOXL2 Partial Recombinant Protein (H00004017-Q01) (0)

There are no publications for Lysyl Oxidase Homolog 2/LOXL2 Partial Recombinant Protein (H00004017-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lysyl Oxidase Homolog 2/LOXL2 Partial Recombinant Protein (H00004017-Q01) (0)

There are no reviews for Lysyl Oxidase Homolog 2/LOXL2 Partial Recombinant Protein (H00004017-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lysyl Oxidase Homolog 2/LOXL2 Partial Recombinant Protein (H00004017-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lysyl Oxidase Homolog 2/LOXL2 Products

Bioinformatics Tool for Lysyl Oxidase Homolog 2/LOXL2 Partial Recombinant Protein (H00004017-Q01)

Discover related pathways, diseases and genes to Lysyl Oxidase Homolog 2/LOXL2 Partial Recombinant Protein (H00004017-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lysyl Oxidase Homolog 2/LOXL2 Partial Recombinant Protein (H00004017-Q01)

Discover more about diseases related to Lysyl Oxidase Homolog 2/LOXL2 Partial Recombinant Protein (H00004017-Q01).
 

Pathways for Lysyl Oxidase Homolog 2/LOXL2 Partial Recombinant Protein (H00004017-Q01)

View related products by pathway.

PTMs for Lysyl Oxidase Homolog 2/LOXL2 Partial Recombinant Protein (H00004017-Q01)

Learn more about PTMs related to Lysyl Oxidase Homolog 2/LOXL2 Partial Recombinant Protein (H00004017-Q01).

Blogs on Lysyl Oxidase Homolog 2/LOXL2

There are no specific blogs for Lysyl Oxidase Homolog 2/LOXL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LOX Antibody
NB100-2527

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Lysyl Oxidase Homolog 2/LOXL2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LOXL2
Entrez