Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen

Images

 
There are currently no images for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen (NBP2-57484PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C.

Source: E. coli

Amino Acid Sequence: ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KDM4C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57484.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen

  • EC 1.14.11
  • EC 1.14.11.-
  • GASC-1 protein
  • GASC1
  • GASC1JmjC domain-containing histone demethylation protein 3C
  • Gene amplified in squamous cell carcinoma 1 protein
  • JHDM3C
  • JMJD2C
  • JMJD2CbA146B14.1
  • jumonji domain containing 2C
  • Jumonji domain-containing protein 2C
  • KDM4C
  • KIAA0780FLJ25949
  • Lysine (K)specific Demethylase 4C
  • Lysine (K)-specific Demethylase 4C
  • lysine-specific demethylase 4C

Background

JMJD2C is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein with one JmjC domain, one JmjN domain, two PHD-type zinc fingers, and two Tudor domains. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form. Chromosomal aberrations and increased transcriptional expression of this gene are associated with esophageal squamous cell carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-40585
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NB100-1762
Species: Hu, Mu, Pm
Applications: ChIP, ELISA, IHC,  IHC-P, KD, Simple Western, WB
NB100-74605
Species: Hu, Mu
Applications: IP, KD, WB
NB100-77282
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IP, KO, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
NB100-81657
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-03357
Species: Hu
Applications: ChIP, ChIP, ICC/IF (-), WB
PP-A8620A-00
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP2-15303
Species: Hu, Mu
Applications: CHIP-SEQ, ICC/IF, IHC,  IHC-P, WB
NB100-56664
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF1555
Species: Hu
Applications: WB
NBP3-13283
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-57484PEP
Species: Hu
Applications: AC

Publications for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen (NBP2-57484PEP) (0)

There are no publications for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen (NBP2-57484PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen (NBP2-57484PEP) (0)

There are no reviews for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen (NBP2-57484PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen (NBP2-57484PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Products

Research Areas for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen (NBP2-57484PEP)

Find related products by research area.

Blogs on Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C

There are no specific blogs for Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KDM4C