Lyn Antibody


Western Blot: Lyn Antibody [NBP1-57583] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Lyn Antibody [NBP1-57583] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Lyn Antibody [NBP1-57583] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: Lyn Antibody [NBP1-57583] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Product Discontinued
View other related Lyn Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Lyn Antibody Summary

Synthetic peptides corresponding to LYN (v-yes-1 Yamaguchi sarcoma viral related oncogene homolog) The peptide sequence was selected from the N terminal of LYN)(50ug). Peptide sequence DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LYN and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Lyn Antibody

  • EC 2.7.10
  • EC
  • FLJ26625
  • Hck-2
  • JTK8
  • Lyn
  • tyrosine-protein kinase Lyn
  • v-yes-1 Yamaguchi sarcoma viral related oncogene homolog
  • v-yes-1
  • Yamaguchi sarcoma viral (v-yes-1) related oncogene homolog


LYN down regulates expression of stem cell growth factor receptor (KIT).LYN acts as an effector of EpoR (erythropoietin receptor) in controlling KIT expression and may play a central role in erythroid differentiation during the switch between proliferation and maturation.LYN acts as a positive regulator of cell movement while negatively regulating adhesion to stromal cells by inhibiting the ICAM-1-binding activity of beta-2 integrins. LYN acts as the mediator that relays suppressing signals from the chemokine receptor CXCR4 to beta-2 integrin LFA-1 in hematopoietic precursors. Involved in induction of stress-activated protein kinase (SAPK), but not ERK or p38 MAPK, in response to genotoxic agents.LYN induces SAPK by a MKK7- and MEKK1-dependent mechanism. The LYN -> MEKK1 -> MKK7 -> SAPK pathway is functional in the induction of apoptosis by genotoxic agents.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: Flow, ICC/IF, IP
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for Lyn Antibody (NBP1-57583) (0)

There are no publications for Lyn Antibody (NBP1-57583).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lyn Antibody (NBP1-57583) (0)

There are no reviews for Lyn Antibody (NBP1-57583). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lyn Antibody (NBP1-57583) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Lyn Antibody (NBP1-57583)

Discover related pathways, diseases and genes to Lyn Antibody (NBP1-57583). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lyn Antibody (NBP1-57583)

Discover more about diseases related to Lyn Antibody (NBP1-57583).

Pathways for Lyn Antibody (NBP1-57583)

View related products by pathway.

PTMs for Lyn Antibody (NBP1-57583)

Learn more about PTMs related to Lyn Antibody (NBP1-57583).

Research Areas for Lyn Antibody (NBP1-57583)

Find related products by research area.

Blogs on Lyn

There are no specific blogs for Lyn, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Lyn Antibody and receive a gift card or discount.


Gene Symbol LYN