Lymphocyte Expansion Molecule Antibody

Images

 
Western Blot: C1orf177 Antibody [NBP1-83457] - Analysis in control (vector only transfected HEK293T lysate) and C1orf177 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: C1orf177 Antibody [NBP1-83457] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lymphocyte Expansion Molecule Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SKPLPYGHYSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWANLSQCPRTLATSGPSFWLPQEKKCKPVNQPPFLLTSKGSGA
Specificity
Specificity of human C1orf177 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C1ORF177
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lymphocyte Expansion Molecule Antibody

  • chromosome 1 open reading frame 177

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Lymphocyte Expansion Molecule Antibody (NBP1-83457) (0)

There are no publications for Lymphocyte Expansion Molecule Antibody (NBP1-83457).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lymphocyte Expansion Molecule Antibody (NBP1-83457) (0)

There are no reviews for Lymphocyte Expansion Molecule Antibody (NBP1-83457). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lymphocyte Expansion Molecule Antibody (NBP1-83457) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lymphocyte Expansion Molecule Products

Bioinformatics Tool for Lymphocyte Expansion Molecule Antibody (NBP1-83457)

Discover related pathways, diseases and genes to Lymphocyte Expansion Molecule Antibody (NBP1-83457). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Lymphocyte Expansion Molecule

There are no specific blogs for Lymphocyte Expansion Molecule, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lymphocyte Expansion Molecule Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C1ORF177