Recombinant Human LYAG/GAA Protein

Images

 

Product Details

Summary
Product Discontinued
View other related LYAG/GAA Peptides and Proteins

Order Details


    • Catalog Number
      H00002548-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human LYAG/GAA Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-102 of Human GAA partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC

Protein/Peptide Type
Partial Recombinant Protein
Gene
GAA

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LYAG/GAA Protein

  • Acid alpha-Glucosidase
  • Acid Maltase
  • Aglucosidase alfa
  • EC 3.2.1.20
  • GAA
  • glucosidase, alpha; acid
  • LYAG
  • Lysosomal alphaGlucosidase
  • Lysosomal alpha-Glucosidase

Background

GAA - glucosidase, alpha; acid (Pompe disease, glycogen storage disease type II)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14036
Species: Hu
Applications: WB, IHC, IHC-P
AF5787
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-87094
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22217
Species: Hu, Mu, Rt(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready

Publications for LYAG/GAA Partial Recombinant Protein (H00002548-Q01) (0)

There are no publications for LYAG/GAA Partial Recombinant Protein (H00002548-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYAG/GAA Partial Recombinant Protein (H00002548-Q01) (0)

There are no reviews for LYAG/GAA Partial Recombinant Protein (H00002548-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYAG/GAA Partial Recombinant Protein (H00002548-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LYAG/GAA Products

Bioinformatics Tool for LYAG/GAA Partial Recombinant Protein (H00002548-Q01)

Discover related pathways, diseases and genes to LYAG/GAA Partial Recombinant Protein (H00002548-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LYAG/GAA Partial Recombinant Protein (H00002548-Q01)

Discover more about diseases related to LYAG/GAA Partial Recombinant Protein (H00002548-Q01).
 

Pathways for LYAG/GAA Partial Recombinant Protein (H00002548-Q01)

View related products by pathway.

PTMs for LYAG/GAA Partial Recombinant Protein (H00002548-Q01)

Learn more about PTMs related to LYAG/GAA Partial Recombinant Protein (H00002548-Q01).

Blogs on LYAG/GAA

There are no specific blogs for LYAG/GAA, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LYAG/GAA Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GAA
Entrez