Ly-6H Antibody (9E406)

Images

 
Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - LY6H monoclonal antibody (M01), clone 3E10 Analysis of LY6H expression in K-562.
Immunohistochemistry-Paraffin: Ly-6H Antibody (3E10) [H00004062-M01] - Analysis of monoclonal antibody to LY6H on formalin-fixed paraffin-embedded human tonsil tissue. Antibody concentration 2 ug/ml.
Western Blot: Ly-6H Antibody (3E10) [H00004062-M01] - Ly-6H in mouse Ly-6H proteins using anti-Ly-6H antibody. Image from verified customer review.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, IHC-P, IP
Clone
9E406
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Ly-6H Antibody (9E406) Summary

Immunogen
LY6H (AAH28894, 26 a.a. - 140 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP
Localization
Cell membrane. Lipid-anchor, GPI-anchor.
Specificity
LY6H - lymphocyte antigen 6 complex, locus H
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LY6H
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
This antibody reactivity against cell lysate and recombinant protein for WB. It has been used for IHC-P and ELISA. IP usage reported in scientific literature (PMID: 25716842).
Reviewed Applications
Read 1 Review rated 5
using
H00004062-M01 in the following applications:

Publications
Read Publications using
H00004062-M01 in the following applications:

  • IHC
    1 publication
  • IP
    1 publication
  • WB
    4 publications

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 23860910).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ly-6H Antibody (9E406)

  • ly-6H
  • lymphocyte antigen 6 complex, locus H
  • lymphocyte antigen 6H
  • NMLY6

Background

LY6H (Lymphocyte antigen 6 complex, Locus H) is a member of the LY6 antigens family of glycosylphosphatidylinositol-anchored cell surface glycoproteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33786
Species: Hu
Applications: WB, IHC, IHC-P
NB300-137
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-24405
Species: Hu
Applications: WB, ELISA
H00002765-M01
Species: Hu
Applications: WB, ELISA
NB600-1387
Species: Hu, Mu
Applications: Flow, Func, IA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80739
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84029
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61674
Species: Hu
Applications: WB, ELISA
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
H00004062-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC-P, IP

Publications for Ly-6H Antibody (H00004062-M01)(5)

Review for Ly-6H Antibody (H00004062-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00004062-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Ly-6H H00004062-M01
Enlarge
reviewed by:
Anonymous
WB Mouse 11/24/2014
View

Summary

ApplicationWestern Blot
SpeciesMouse
Special ApplicationsHello, we have used your rat-Ly6h antibody and shown that is recognizes the mouse Ly6h protein and is specific for Ly6h when tested on several other mouse Ly6 proteins (See attached pdf). Since this antibody was previously only validated for rat Ly6h, we would like to submit this data to request the antibody purchase credit. The order information is included in the forwarded email below. Please let me know if there is anything further you require for us to receive the credit.
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ly-6H Antibody (H00004062-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Ly-6H Antibody (H00004062-M01)

Discover related pathways, diseases and genes to Ly-6H Antibody (H00004062-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ly-6H Antibody (H00004062-M01)

Discover more about diseases related to Ly-6H Antibody (H00004062-M01).

Research Areas for Ly-6H Antibody (H00004062-M01)

Find related products by research area.

Blogs on Ly-6H

There are no specific blogs for Ly-6H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
11/24/2014
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol LY6H
Entrez
OMIM
Uniprot