Ly-6G6F Antibody


Western Blot: Ly-6G6F Antibody [NBP1-70761] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: Ly-6G6F Antibody [NBP1-70761] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Ly-6G6F Antibody Summary

Synthetic peptides corresponding to LY6G6F The peptide sequence was selected from the N terminal of LY6G6F. Peptide sequence CSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEED.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ly-6G6F Antibody

  • C6orf21
  • G6f
  • locus G6D
  • LY6G6D
  • LY6G6F
  • Ly-6G6F
  • lymphocyte antigen 6 complex locus protein G6f
  • lymphocyte antigen 6 complex, locus G6F
  • NG32


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: WB
Species: Mu
Applications: Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Ly-6G6F Antibody (NBP1-70761) (0)

There are no publications for Ly-6G6F Antibody (NBP1-70761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ly-6G6F Antibody (NBP1-70761) (0)

There are no reviews for Ly-6G6F Antibody (NBP1-70761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ly-6G6F Antibody (NBP1-70761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Ly-6G6F Products

Bioinformatics Tool for Ly-6G6F Antibody (NBP1-70761)

Discover related pathways, diseases and genes to Ly-6G6F Antibody (NBP1-70761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ly-6G6F Antibody (NBP1-70761)

Discover more about diseases related to Ly-6G6F Antibody (NBP1-70761).

Pathways for Ly-6G6F Antibody (NBP1-70761)

View related products by pathway.

PTMs for Ly-6G6F Antibody (NBP1-70761)

Learn more about PTMs related to Ly-6G6F Antibody (NBP1-70761).

Blogs on Ly-6G6F

There are no specific blogs for Ly-6G6F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Ly-6G6F Antibody and receive a gift card or discount.


Gene Symbol LY6G6F