LSM3 Antibody (4C8-2D10) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related LSM3 Primary Antibodies

Order Details


    • Catalog Number
      H00027258-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LSM3 Antibody (4C8-2D10) [PerCP] Summary

Immunogen
LSM3 (AAH07055, 1 a.a. ~ 103 a.a) full length recombinant protein with GST tag.MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGR LHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPM LFVRGDGVVLVAPPLRVG
Localization
Nuclear
Specificity
LSM3 - LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LSM3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LSM3 Antibody (4C8-2D10) [PerCP]

  • LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae)
  • SMX4
  • U6 snRNA-associated Sm-like protein LSm3
  • USS2
  • YLR438C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-92082
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92083
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-45836
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-87307
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4509
Species: Hu
Applications: WB, ICC
NBP2-00918
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001164-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-53095
Species: Hu, Mu, Rt, Po, Bv, Mk, Rb, Sh, Ze
Applications: WB, ICC/IF, IHC-P
NBP1-86846
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48937
Species: Hu
Applications: WB, ICC/IF, IHC
AF5866
Species: Hu
Applications: WB, IHC

Publications for LSM3 Antibody (H00027258-M01PCP) (0)

There are no publications for LSM3 Antibody (H00027258-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSM3 Antibody (H00027258-M01PCP) (0)

There are no reviews for LSM3 Antibody (H00027258-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LSM3 Antibody (H00027258-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LSM3 Products

Bioinformatics Tool for LSM3 Antibody (H00027258-M01PCP)

Discover related pathways, diseases and genes to LSM3 Antibody (H00027258-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LSM3 Antibody (H00027258-M01PCP)

Discover more about diseases related to LSM3 Antibody (H00027258-M01PCP).
 

Pathways for LSM3 Antibody (H00027258-M01PCP)

View related products by pathway.

PTMs for LSM3 Antibody (H00027258-M01PCP)

Learn more about PTMs related to LSM3 Antibody (H00027258-M01PCP).

Blogs on LSM3

There are no specific blogs for LSM3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LSM3 Antibody (4C8-2D10) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol LSM3