LRRC71 Antibody

Images

 
Immunohistochemistry: LRRC71 Antibody [NBP1-88319] - Staining of human hippocampus shows moderate nucleolar positivity in neuronal cells.

Product Details

Summary
Product Discontinued
View other related LRRC71 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-88319
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LRRC71 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LNRSLLWLSLAHNRIQDKGALKLAEVLRAFELTHTEVVERRRLLLEKGTQERSRSPSSSRHGDSKTDREKSQMVGISNSALVDKTDKTQTMKTPKG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC71
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRC71 Antibody

  • leucine rich repeat containing 71
  • leucine-rich repeat-containing protein 71
  • leucine-rich repeat-containing protein C10orf92
  • MGC45468

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LRRC71 Antibody (NBP1-88319) (0)

There are no publications for LRRC71 Antibody (NBP1-88319).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC71 Antibody (NBP1-88319) (0)

There are no reviews for LRRC71 Antibody (NBP1-88319). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LRRC71 Antibody (NBP1-88319) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRC71 Products

LRRC71 NBP1-88319

Bioinformatics Tool for LRRC71 Antibody (NBP1-88319)

Discover related pathways, diseases and genes to LRRC71 Antibody (NBP1-88319). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LRRC71

There are no specific blogs for LRRC71, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC71 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC71