LRRC39 Antibody

Images

 
Western Blot: LRRC39 Antibody [NBP1-81198] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: LRRC39 Antibody [NBP1-81198] - Staining in human skeletal muscle and liver tissues. Corresponding LRRC39 RNA-seq data are presented for the same tissues.
Western Blot: LRRC39 Antibody [NBP1-81198] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: LRRC39 Antibody [NBP1-81198] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: LRRC39 Antibody [NBP1-81198] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: LRRC39 Antibody [NBP1-81198] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: LRRC39 Antibody [NBP1-81198] - Staining of human skeletal muscle shows moderate positivity in myocytes.
Immunohistochemistry-Paraffin: LRRC39 Antibody [NBP1-81198] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Product Discontinued
View other related LRRC39 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-81198
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LRRC39 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TGAVNAVKEVWEKRIKKLNEDLKREKEFQHKLVRIWEERVSLTKLREKVTREDGRVILKIEKEEWKTLPSSLLKLNQLQEWQ
Specificity
Specificity of human, mouse, rat LRRC39 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC39
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRC39 Antibody

  • Densin hlg
  • DKFZp313O1122
  • leucine rich repeat containing 39
  • leucine-rich repeat-containing protein 39
  • MGC14816

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86460
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB9096
Species: Hu
Applications: WB, IHC
NBP2-46201
Species: Hu
Applications: WB, IHC
NB600-1032
Species: Hu, Mu, Rt, Ba
Applications: WB, ICC/IF, IHC
NBP1-81198
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for LRRC39 Antibody (NBP1-81198) (0)

There are no publications for LRRC39 Antibody (NBP1-81198).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC39 Antibody (NBP1-81198) (0)

There are no reviews for LRRC39 Antibody (NBP1-81198). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRRC39 Antibody (NBP1-81198) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRC39 Products

Bioinformatics Tool for LRRC39 Antibody (NBP1-81198)

Discover related pathways, diseases and genes to LRRC39 Antibody (NBP1-81198). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC39 Antibody (NBP1-81198)

Discover more about diseases related to LRRC39 Antibody (NBP1-81198).

Blogs on LRRC39

There are no specific blogs for LRRC39, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC39 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC39