LRP12 Antibody

Images

 
Immunohistochemistry-Paraffin: LRP12 Antibody [NBP1-83707] - Staining of human epididymis shows moderate cytoplasmic and nucleolar positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRP12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FPVCSPNQASVLENLRLAVRSQLGFTSVRLPMAGRSSNIWNRIFNFARSRHSGSLALVSADGDEVVPSQSTSREPERNHTHRSLFSVESDDTDTENERRDMAGASGGVAAPLPQKVPPTTAVEATVGACASSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRP12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LRP12 Protein (NBP1-83707PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRP12 Antibody

  • low density lipoprotein receptor-related protein 12
  • suppressor of tumorigenicity 7 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006386-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-13391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56641
Species: Hu, Mu
Applications: WB
NBP1-83926
Species: Hu
Applications: IHC, IHC-P
AF5828
Species: Hu
Applications: WB, ICC, Neut
NBP2-55685
Species: Hu
Applications: ICC/IF
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57521
Species: Hu
Applications: ICC/IF
AF523
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready, Neut
MAB3657
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-77148
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
AF756
Species: Mu
Applications: WB, IHC
NBP1-87987
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1734
Species: Hu
Applications: WB, IP
3900-WN/CF
Species: Mu
NBP1-83707
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for LRP12 Antibody (NBP1-83707) (0)

There are no publications for LRP12 Antibody (NBP1-83707).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRP12 Antibody (NBP1-83707) (0)

There are no reviews for LRP12 Antibody (NBP1-83707). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LRP12 Antibody (NBP1-83707) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRP12 Products

Bioinformatics Tool for LRP12 Antibody (NBP1-83707)

Discover related pathways, diseases and genes to LRP12 Antibody (NBP1-83707). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRP12 Antibody (NBP1-83707)

Discover more about diseases related to LRP12 Antibody (NBP1-83707).
 

Pathways for LRP12 Antibody (NBP1-83707)

View related products by pathway.

Blogs on LRP12

There are no specific blogs for LRP12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRP12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRP12