LRMP/Jaw1 Antibody

Images

 
Western Blot: LRMP/Jaw1 Antibody [NBP2-87739] - Host: Rabbit. Target Name: LRMP. Sample Tissue: Human DLD1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRMP/Jaw1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LRMP/Jaw1. Peptide sequence: PSSLRRVTIASLPRNIGNAGMVAGMENNDRFSRRSSSWRILGSKQSEHRP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
LRMP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRMP/Jaw1 Antibody

  • Jaw1
  • JAW1Protein Jaw1
  • LRMP
  • lymphoid-restricted membrane protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
NBP1-83810
Species: Hu
Applications: IHC, IHC-P
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-21399
Species: Hu
Applications: WB (-), IHC, IHC-P
NBP2-16987
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01826
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P
NBP1-90044
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-2466
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87942
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001908-M01
Species: Hu
Applications: WB, ELISA, IP
NBP2-50062
Species: Hu, Mu(-), Rt(-)
Applications: WB, ICC/IF, IHC
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-87739
Species: Hu
Applications: WB

Publications for LRMP/Jaw1 Antibody (NBP2-87739) (0)

There are no publications for LRMP/Jaw1 Antibody (NBP2-87739).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRMP/Jaw1 Antibody (NBP2-87739) (0)

There are no reviews for LRMP/Jaw1 Antibody (NBP2-87739). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRMP/Jaw1 Antibody (NBP2-87739) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LRMP/Jaw1 Products

Bioinformatics Tool for LRMP/Jaw1 Antibody (NBP2-87739)

Discover related pathways, diseases and genes to LRMP/Jaw1 Antibody (NBP2-87739). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRMP/Jaw1 Antibody (NBP2-87739)

Discover more about diseases related to LRMP/Jaw1 Antibody (NBP2-87739).
 

Pathways for LRMP/Jaw1 Antibody (NBP2-87739)

View related products by pathway.

PTMs for LRMP/Jaw1 Antibody (NBP2-87739)

Learn more about PTMs related to LRMP/Jaw1 Antibody (NBP2-87739).

Blogs on LRMP/Jaw1

There are no specific blogs for LRMP/Jaw1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRMP/Jaw1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRMP