LRGUK Antibody

Images

 
Western Blot: LRGUK Antibody [NBP1-83517] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: LRGUK Antibody [NBP1-83517] - Staining of human kidney shows distinct membranous positivity in tubule cells.

Product Details

Summary
Product Discontinued
View other related LRGUK Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83517
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LRGUK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ENPIQEKSEYWFFVIFMLLRLTELDQKKIKVEEKVSAVNKYDPPPEVVAAQDHLTHVVNSVMQPQRIFDSTLPSLDAPYPMLILAGPEACGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRGUK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRGUK Antibody

  • FLJ32786
  • leucine-rich repeat and guanylate kinase domain-containing protein
  • leucine-rich repeats and guanylate kinase domain containing

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-97492
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fi, GP, Ha, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83517
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for LRGUK Antibody (NBP1-83517) (0)

There are no publications for LRGUK Antibody (NBP1-83517).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRGUK Antibody (NBP1-83517) (0)

There are no reviews for LRGUK Antibody (NBP1-83517). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRGUK Antibody (NBP1-83517) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRGUK Products

Bioinformatics Tool for LRGUK Antibody (NBP1-83517)

Discover related pathways, diseases and genes to LRGUK Antibody (NBP1-83517). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRGUK Antibody (NBP1-83517)

Discover more about diseases related to LRGUK Antibody (NBP1-83517).
 

Pathways for LRGUK Antibody (NBP1-83517)

View related products by pathway.

Blogs on LRGUK

There are no specific blogs for LRGUK, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRGUK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRGUK