LRAT Antibody

Images

 
Immunohistochemistry: LRAT Antibody [NBP1-86488] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRAT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EDKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLGDNRVAHMMPDILLALTDDM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LRAT Protein (NBP1-86488PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRAT Antibody

  • EC 2.3.1.135
  • LCA14
  • lecithin retinol acyltransferase (phosphatidylcholine--retinolO-acyltransferase)
  • lecithin retinol acyltransferase
  • MGC33103
  • Phosphatidylcholine--retinol O-acyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
NBP1-71701
Species: Hu, Mu
Applications: WB
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
H00064220-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP1-80851
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74392
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-55057
Species: Hu
Applications: ICC/IF

Publications for LRAT Antibody (NBP1-86488) (0)

There are no publications for LRAT Antibody (NBP1-86488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRAT Antibody (NBP1-86488) (0)

There are no reviews for LRAT Antibody (NBP1-86488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LRAT Antibody (NBP1-86488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRAT Products

Bioinformatics Tool for LRAT Antibody (NBP1-86488)

Discover related pathways, diseases and genes to LRAT Antibody (NBP1-86488). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRAT Antibody (NBP1-86488)

Discover more about diseases related to LRAT Antibody (NBP1-86488).
 

Pathways for LRAT Antibody (NBP1-86488)

View related products by pathway.

PTMs for LRAT Antibody (NBP1-86488)

Learn more about PTMs related to LRAT Antibody (NBP1-86488).

Blogs on LRAT

There are no specific blogs for LRAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRAT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRAT