LRAT Antibody


Immunohistochemistry: LRAT Antibody [NBP1-86488] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Product Discontinued
View other related LRAT Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LRAT Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EDKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLGDNRVAHMMPDILLALTDDM
Specificity of human LRAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LRAT Antibody

  • EC
  • LCA14
  • lecithin retinol acyltransferase (phosphatidylcholine--retinolO-acyltransferase)
  • lecithin retinol acyltransferase
  • MGC33103
  • Phosphatidylcholine--retinol O-acyltransferase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB

Publications for LRAT Antibody (NBP1-86488) (0)

There are no publications for LRAT Antibody (NBP1-86488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRAT Antibody (NBP1-86488) (0)

There are no reviews for LRAT Antibody (NBP1-86488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LRAT Antibody (NBP1-86488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LRAT Products

Bioinformatics Tool for LRAT Antibody (NBP1-86488)

Discover related pathways, diseases and genes to LRAT Antibody (NBP1-86488). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRAT Antibody (NBP1-86488)

Discover more about diseases related to LRAT Antibody (NBP1-86488).

Pathways for LRAT Antibody (NBP1-86488)

View related products by pathway.

PTMs for LRAT Antibody (NBP1-86488)

Learn more about PTMs related to LRAT Antibody (NBP1-86488).

Blogs on LRAT

There are no specific blogs for LRAT, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LRAT Antibody and receive a gift card or discount.


Gene Symbol LRAT