LPP Antibody

Images

 
Western Blot: LPP Antibody [NBP1-52967] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related LPP Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52967
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LPP Antibody Summary

Immunogen
Synthetic peptides corresponding to LPP(LIM domain containing preferred translocation partner in lipoma) The peptide sequence was selected from the N terminal of LPP. Peptide sequence GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST.
Clonality
Polyclonal
Host
Rabbit
Gene
LPP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LPP and was validated on Western blot.
Theoretical MW
67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LPP Antibody

  • DKFZp779O0231
  • FLJ30652
  • FLJ41512
  • LIM domain containing preferred translocation partner in lipoma
  • LIM domain-containing preferred translocation partner in lipoma
  • LIM protein
  • lipoma-preferred partner
  • LPP

Background

LPP may play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. LPP may be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion sites. LPP is also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP2-02654
Species: Hu, Rt
Applications: WB, Flow, ICC/IF
NBP1-89570
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5626
Species: Hu
Applications: WB, ICC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP1-84978
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LPP Antibody (NBP1-52967) (0)

There are no publications for LPP Antibody (NBP1-52967).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LPP Antibody (NBP1-52967) (0)

There are no reviews for LPP Antibody (NBP1-52967). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LPP Antibody (NBP1-52967) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LPP Products

Bioinformatics Tool for LPP Antibody (NBP1-52967)

Discover related pathways, diseases and genes to LPP Antibody (NBP1-52967). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LPP Antibody (NBP1-52967)

Discover more about diseases related to LPP Antibody (NBP1-52967).
 

Pathways for LPP Antibody (NBP1-52967)

View related products by pathway.

PTMs for LPP Antibody (NBP1-52967)

Learn more about PTMs related to LPP Antibody (NBP1-52967).

Blogs on LPP

There are no specific blogs for LPP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LPP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LPP
Entrez
Uniprot