Low Density LRP Antibody

Images

 
Western Blot: Low Density LRP Antibody [NBP1-54372] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Product Details

Summary
Product Discontinued
View other related Low Density LRP Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54372
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Low Density LRP Antibody Summary

Immunogen
Synthetic peptides corresponding to LRP1(low density lipoprotein-related protein 1 (alpha-2-macroglobulin receptor)) The peptide sequence was selected from the middle region of LRP1. Peptide sequence ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGD
Clonality
Polyclonal
Host
Rabbit
Gene
LRP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LRP1 and was validated on Western blot.
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Low Density LRP Antibody

  • A2MRTGFBR5
  • Alpha-2-macroglobulin receptorMGC88725
  • APOER
  • Apolipoprotein E receptor
  • APR
  • CD91 antigen
  • CD91
  • EC 1.1.1.94
  • EC 3.4.21.9
  • FLJ16451
  • IGFBP3R
  • low density lipoprotein receptor-related protein 1
  • LRP
  • LRP-1
  • prolow-density lipoprotein receptor-related protein 1
  • TbetaR-V/LRP-1/IGFBP-3 receptor
  • type V tgf-beta receptor

Background

Low-density lipoprotein receptor-related protein 1 (.-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-46466
Species: Hu
Applications: IHC
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Low Density LRP Antibody (NBP1-54372) (0)

There are no publications for Low Density LRP Antibody (NBP1-54372).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Low Density LRP Antibody (NBP1-54372) (0)

There are no reviews for Low Density LRP Antibody (NBP1-54372). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Low Density LRP Antibody (NBP1-54372) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Low Density LRP Products

Bioinformatics Tool for Low Density LRP Antibody (NBP1-54372)

Discover related pathways, diseases and genes to Low Density LRP Antibody (NBP1-54372). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Low Density LRP Antibody (NBP1-54372)

Discover more about diseases related to Low Density LRP Antibody (NBP1-54372).
 

Pathways for Low Density LRP Antibody (NBP1-54372)

View related products by pathway.

PTMs for Low Density LRP Antibody (NBP1-54372)

Learn more about PTMs related to Low Density LRP Antibody (NBP1-54372).

Blogs on Low Density LRP

There are no specific blogs for Low Density LRP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Low Density LRP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRP1
Uniprot