LMW-PTP/ACP1 Antibody

Product Discontinued

LMW-PTP/ACP1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ACP1(acid phosphatase 1, soluble) The peptide sequence was selected from the N terminal of ACP1. Peptide sequence PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP.
• Predicted Species: Mouse (92%), Rat (100%), Porcine (92%), Rabbit (100%), Equine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACP1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against ACP1 and was validated on Western Blot and immunohistochemistry-P
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LMW-PTP/ACP1 Antibody

• acid phosphatase 1, soluble
• acid phosphatase of erythrocyte
• ACP1
• Adipocyte acid phosphatase
• cytoplasmic phosphotyrosyl protein phosphatase
• EC 3.1.3.2
• EC 3.1.3.48
• HAAP
• LMWPTP
• LMW-PTP
• LMW-PTPase
• Low molecular weight cytosolic acid phosphatase
• low molecular weight phosphotyrosine protein phosphatase
• MGC111030
• MGC3499
• protein tyrosine phosphatase
• Red cell acid phosphatase 1

Background

ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate.The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Three transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACP1
• Uniprot:
  • P24666()