LMW-PTP/ACP1 Antibody

Images

 

Product Details

Summary
Product Discontinued
View other related LMW-PTP/ACP1 Primary Antibodies

Order Details


    • Catalog Number
      H00000052-D01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LMW-PTP/ACP1 Antibody Summary

Immunogen
ACP1 (NP_009030.1, 1 a.a. - 158 a.a.) full-length human protein. MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Specificity
ACP1 - acid phosphatase 1, soluble,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMW-PTP/ACP1 Antibody

  • acid phosphatase 1, soluble
  • acid phosphatase of erythrocyte
  • ACP1
  • Adipocyte acid phosphatase
  • cytoplasmic phosphotyrosyl protein phosphatase
  • EC 3.1.3.2
  • EC 3.1.3.48
  • HAAP
  • LMWPTP
  • LMW-PTP
  • LMW-PTPase
  • Low molecular weight cytosolic acid phosphatase
  • low molecular weight phosphotyrosine protein phosphatase
  • MGC111030
  • MGC3499
  • protein tyrosine phosphatase
  • Red cell acid phosphatase 1

Background

The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005236-M01
Species: Hu, Bv
Applications: WB, ELISA, ICC/IF, IP, RNAi, S-ELISA
NBP2-66825
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NBP2-66881
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NB300-917
Species: Hu, Mu
Applications: IHC, IHC-P, IF
NBP2-45880
Species: Hu
Applications: WB, IHC, IHC-P, IF
NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89111
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NB100-65887
Species: Hu
Applications: Flow, IP
NBP2-84247
Species: Hu
Applications: WB
NBP2-81923
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA

Publications for LMW-PTP/ACP1 Antibody (H00000052-D01P) (0)

There are no publications for LMW-PTP/ACP1 Antibody (H00000052-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMW-PTP/ACP1 Antibody (H00000052-D01P) (0)

There are no reviews for LMW-PTP/ACP1 Antibody (H00000052-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMW-PTP/ACP1 Antibody (H00000052-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LMW-PTP/ACP1 Products

Bioinformatics Tool for LMW-PTP/ACP1 Antibody (H00000052-D01P)

Discover related pathways, diseases and genes to LMW-PTP/ACP1 Antibody (H00000052-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMW-PTP/ACP1 Antibody (H00000052-D01P)

Discover more about diseases related to LMW-PTP/ACP1 Antibody (H00000052-D01P).
 

Pathways for LMW-PTP/ACP1 Antibody (H00000052-D01P)

View related products by pathway.

PTMs for LMW-PTP/ACP1 Antibody (H00000052-D01P)

Learn more about PTMs related to LMW-PTP/ACP1 Antibody (H00000052-D01P).
 

Research Areas for LMW-PTP/ACP1 Antibody (H00000052-D01P)

Find related products by research area.

Blogs on LMW-PTP/ACP1

There are no specific blogs for LMW-PTP/ACP1, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMW-PTP/ACP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACP1
Entrez
Uniprot