Recombinant Human LMTK3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LMTK3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1151 - 1250 of Human LMTK3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPG

Protein/Peptide Type
Partial Recombinant Protein
Gene
LMTK3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LMTK3 Protein

  • AATYK3
  • EC 2.7.11.1
  • lemur tyrosine kinase 3KIAA1883TYKLM3LMR3
  • serine/threonine-protein kinase LMTK3

Background

LMTK3 - lemur tyrosine kinase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
AF2988
Species: Mu, Rt
Applications: WB
AF1016
Species: Hu
Applications: WB, Neut
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
AF641
Species: Mu
Applications: WB, IHC
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-37292
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
AF2000
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
H00114783-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for LMTK3 Partial Recombinant Protein (H00114783-Q01) (0)

There are no publications for LMTK3 Partial Recombinant Protein (H00114783-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMTK3 Partial Recombinant Protein (H00114783-Q01) (0)

There are no reviews for LMTK3 Partial Recombinant Protein (H00114783-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMTK3 Partial Recombinant Protein (H00114783-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LMTK3 Products

Bioinformatics Tool for LMTK3 Partial Recombinant Protein (H00114783-Q01)

Discover related pathways, diseases and genes to LMTK3 Partial Recombinant Protein (H00114783-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMTK3 Partial Recombinant Protein (H00114783-Q01)

Discover more about diseases related to LMTK3 Partial Recombinant Protein (H00114783-Q01).

PTMs for LMTK3 Partial Recombinant Protein (H00114783-Q01)

Learn more about PTMs related to LMTK3 Partial Recombinant Protein (H00114783-Q01).
 

Research Areas for LMTK3 Partial Recombinant Protein (H00114783-Q01)

Find related products by research area.

Blogs on LMTK3

There are no specific blogs for LMTK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LMTK3 Antibody (2H6)
H00114783-M02
FOXO3 Antibody
NBP2-16521

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LMTK3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LMTK3