LMP7/PSMB8 Antibody (1B3) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related LMP7/PSMB8 Primary Antibodies

Order Details


    • Catalog Number
      H00005696-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LMP7/PSMB8 Antibody (1B3) [PerCP] Summary

Immunogen
PSMB8 (AAH01114 173 a.a. - 272 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
Specificity
PSMB8 - proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional protease 7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PSMB8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMP7/PSMB8 Antibody (1B3) [PerCP]

  • ALDD
  • beta5i
  • D6S216E
  • EC 3.4.25.1
  • JMP
  • LMP7
  • LMP7MGC1491
  • Low molecular mass protein 7
  • low molecular weight protein 7
  • Macropain subunit C13
  • Multicatalytic endopeptidase complex subunit C13
  • NKJO
  • protease component C13
  • proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalpeptidase 7)
  • proteasome catalytic subunit 3i
  • Proteasome Component C13
  • proteasome subunit beta 5i
  • proteasome subunit beta type-8
  • Proteasome subunit beta-5i
  • Proteasome Subunit Y2
  • proteasome-related gene 7
  • PSMB5i
  • PSMB5iD6S216
  • PSMB8
  • Really interesting new gene 10 protein
  • RING10
  • RING10proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalprotease 7)
  • Y2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88660
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NLS1071
Species: Hu
Applications: IHC-P
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1538
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-83121
Species: Hu
Applications: WB, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00005696-M01PCP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for LMP7/PSMB8 Antibody (H00005696-M01PCP) (0)

There are no publications for LMP7/PSMB8 Antibody (H00005696-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMP7/PSMB8 Antibody (H00005696-M01PCP) (0)

There are no reviews for LMP7/PSMB8 Antibody (H00005696-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LMP7/PSMB8 Antibody (H00005696-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMP7/PSMB8 Products

Bioinformatics Tool for LMP7/PSMB8 Antibody (H00005696-M01PCP)

Discover related pathways, diseases and genes to LMP7/PSMB8 Antibody (H00005696-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMP7/PSMB8 Antibody (H00005696-M01PCP)

Discover more about diseases related to LMP7/PSMB8 Antibody (H00005696-M01PCP).
 

Pathways for LMP7/PSMB8 Antibody (H00005696-M01PCP)

View related products by pathway.

PTMs for LMP7/PSMB8 Antibody (H00005696-M01PCP)

Learn more about PTMs related to LMP7/PSMB8 Antibody (H00005696-M01PCP).
 

Research Areas for LMP7/PSMB8 Antibody (H00005696-M01PCP)

Find related products by research area.

Blogs on LMP7/PSMB8

There are no specific blogs for LMP7/PSMB8, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMP7/PSMB8 Antibody (1B3) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMB8
Entrez