LMO7 Antibody (4B4) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related LMO7 Primary Antibodies

Order Details


    • Catalog Number
      H00004008-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LMO7 Antibody (4B4) [PerCP] Summary

Immunogen
LMO7 (NP_005349 453 a.a. - 540 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATYPSEIPKEDSTTFAKREDRVTTEIQLPSQSPVEEQSP
Specificity
LMO7 (4B4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LMO7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMO7 Antibody (4B4) [PerCP]

  • FBX20F-box only protein 20
  • KIAA0858FBXO20F-box protein Fbx20
  • LIM domain 7
  • LIM domain only 7
  • LIM domain only protein 7
  • LMO-7
  • LOMP
  • zinc-finger domain-containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF7829
Species: Hu
Applications: WB, IHC, ICC
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
H00009124-D01P
Species: Hu
Applications: WB, ELISA
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6008
Species: Hu, Mu, Rt
Applications: WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-00597
Species: Hu, Mk
Applications: WB, Flow, ICC/IF
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP1-26650
Species: Hu, Mu
Applications: WB, IP
NBP1-87745
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF

Publications for LMO7 Antibody (H00004008-M01PCP) (0)

There are no publications for LMO7 Antibody (H00004008-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMO7 Antibody (H00004008-M01PCP) (0)

There are no reviews for LMO7 Antibody (H00004008-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LMO7 Antibody (H00004008-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMO7 Products

LMO7 H00004008-M01PCP

Bioinformatics Tool for LMO7 Antibody (H00004008-M01PCP)

Discover related pathways, diseases and genes to LMO7 Antibody (H00004008-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMO7 Antibody (H00004008-M01PCP)

Discover more about diseases related to LMO7 Antibody (H00004008-M01PCP).
 

Pathways for LMO7 Antibody (H00004008-M01PCP)

View related products by pathway.

Blogs on LMO7

There are no specific blogs for LMO7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMO7 Antibody (4B4) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol LMO7